BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021311 (667 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43151| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 >SB_43151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1719 Score = 31.1 bits (67), Expect = 0.84 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = -3 Query: 572 WILEKKRSSQKH*VNLLPKQNLNFVYGLKLYKH 474 W+ EK+ + +H +L PK+N ++V G+KL +H Sbjct: 411 WLYEKQSCTDRHVKHLCPKKNCDWV-GVKLERH 442 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/35 (51%), Positives = 21/35 (60%) Frame = +2 Query: 401 YKKKELRINE*LQSNSIAETKNKTDAYTV*ARKQN 505 YKKK +NE LQ+ AETKNK + A KQN Sbjct: 638 YKKKNNELNEALQA---AETKNKAMEKEIDALKQN 669 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,319,722 Number of Sequences: 59808 Number of extensions: 298862 Number of successful extensions: 447 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -