BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021297 (686 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0574 + 4247469-4248196,4249501-4249691,4250565-4251022 29 3.5 11_06_0498 - 24344454-24344660,24344840-24344944,24345324-243454... 28 6.0 08_02_1605 - 28166338-28166418,28166496-28166567,28166655-281667... 28 6.0 04_03_0306 + 14136338-14136686,14137408-14137442,14137701-141377... 28 8.0 >02_01_0574 + 4247469-4248196,4249501-4249691,4250565-4251022 Length = 458 Score = 29.1 bits (62), Expect = 3.5 Identities = 22/78 (28%), Positives = 32/78 (41%) Frame = +3 Query: 267 QCSALYGVRILFAAKTHCHCAKTYRHE*TRDPTSSGSKDQNEANRTSSQPVPMASSNSSY 446 QCS + + AK C T + R PT+ G ++ S+ AS SSY Sbjct: 240 QCSRFHVLAEFDEAKRSCRKRLTEHNRRRRKPTAGGQSSKDSPPPPPSKKGTDASIASSY 299 Query: 447 FSGEPIHFRVRGSTITGA 500 S + H + ST T + Sbjct: 300 TSCD--HHKAAASTTTAS 315 >11_06_0498 - 24344454-24344660,24344840-24344944,24345324-24345407, 24345523-24345615,24345795-24345920,24347157-24347315, 24347398-24347475,24348316-24348375,24349433-24349555, 24349961-24350041 Length = 371 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -3 Query: 678 STLCAMVSSTKFLVTVVWRIKWFQLKIVINQPISWAK 568 STL M S+KFL + W + WF + + + SWAK Sbjct: 75 STLAVMKKSSKFLPVIGWSM-WFAEYLFLER--SWAK 108 >08_02_1605 - 28166338-28166418,28166496-28166567,28166655-28166771, 28166846-28166956,28167077-28167252,28167340-28167421, 28167662-28167808,28167887-28168252,28168558-28168741, 28169104-28169213,28169452-28169508,28169589-28169600, 28169899-28169961,28170010-28170057,28170166-28170246, 28170326-28170389,28170661-28170686,28170782-28170868, 28170942-28170969,28171194-28171255,28171364-28171576, 28171667-28171774,28171948-28172022,28172136-28172249, 28172597-28172644,28172688-28172767,28172974-28173049, 28173287-28173427,28173685-28173762,28175100-28175204, 28177061-28177147,28177287-28178579 Length = 1463 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 672 LCAMVSSTKFLVTVVWRIKWFQLKIVINQPI 580 LC + T L+ VVWR W ++ N P+ Sbjct: 438 LCGVALQTLILLFVVWRTDWKAESLIPNPPL 468 >04_03_0306 + 14136338-14136686,14137408-14137442,14137701-14137778, 14138046-14138124,14138731-14138823,14139472-14139556, 14140270-14140345,14140669-14140794,14141039-14141137, 14141238-14141339,14141561-14141671,14141809-14141904, 14142488-14142539,14142624-14142735,14142879-14142943, 14144124-14144521,14145236-14145330,14145989-14146015, 14146081-14146156,14146368-14146421,14146741-14146863, 14146955-14147023 Length = 799 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +3 Query: 360 PTSSGSKDQNEANRTSSQPVPM-ASSNSSY 446 P S+G + + E N+T+SQPV + A+SN Y Sbjct: 634 PPSNG-RTERERNKTASQPVQLNATSNGDY 662 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,912,806 Number of Sequences: 37544 Number of extensions: 415079 Number of successful extensions: 1003 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 980 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1003 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -