BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021295 (731 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 23 3.4 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 23 3.4 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 7.8 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 22.6 bits (46), Expect = 3.4 Identities = 14/53 (26%), Positives = 21/53 (39%) Frame = -2 Query: 541 SLNDCTRYIAIQDPTAMSPQEMAASAQISAGAVVSLSTGSKWDSTSSRCVPAY 383 S DC + + +PT M + G + STG KW + PA+ Sbjct: 91 SPEDCE--LVLSNPTHMEKSAIYNLLHDWLGTGLLTSTGLKWQTRRKILTPAF 141 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 22.6 bits (46), Expect = 3.4 Identities = 14/53 (26%), Positives = 21/53 (39%) Frame = -2 Query: 541 SLNDCTRYIAIQDPTAMSPQEMAASAQISAGAVVSLSTGSKWDSTSSRCVPAY 383 S DC + + +PT M + G + STG KW + PA+ Sbjct: 91 SPEDCE--LVLSNPTHMEKSAIYNLLHDWLGTGLLTSTGLKWQTRRKILTPAF 141 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 551 DNKDLHSSTYARFLHLGLGL 610 D +H+S R + LGLG+ Sbjct: 668 DEPQVHASRIYRMIKLGLGI 687 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,212 Number of Sequences: 336 Number of extensions: 3769 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -