BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021294 (745 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 27 0.81 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 7.5 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 23 7.5 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 23 10.0 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 26.6 bits (56), Expect = 0.81 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 4/51 (7%) Frame = +3 Query: 123 KYSELRDTINTSCD----IELLEACRHEFHRRLKVYHAWKAKNARKSTCSS 263 +++ELR N + D ++++ R EF++R A+ KN+ S SS Sbjct: 54 EFTELRKAFNETVDDSEAFDIMQKDRREFNKRSHEVRAFLLKNSSHSGASS 104 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 7.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 497 SAPARSSTGVLSGCSSICRATYCPSK 420 S+ RSSTG+L G ++ A+ P K Sbjct: 439 SSSERSSTGILGGTAAYLPASINPVK 464 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 23.4 bits (48), Expect = 7.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 497 SAPARSSTGVLSGCSSICRATYCPSK 420 S+ RSSTG+L G ++ A+ P K Sbjct: 440 SSSERSSTGILGGTAAYLPASINPVK 465 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 23.0 bits (47), Expect = 10.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 67 RSDLFNLFSPFSASAGGKL 11 R D F+LF+P A GKL Sbjct: 92 RRDSFSLFNPEHRKAAGKL 110 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 501,342 Number of Sequences: 2352 Number of extensions: 8067 Number of successful extensions: 23 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -