BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021292 (691 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 23 2.4 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 5.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.2 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 9.5 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 9.5 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 23.0 bits (47), Expect = 2.4 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 555 NSSPTSPCRHGGG*GPYPNHA 617 ++SP P H PYP+H+ Sbjct: 331 STSPNLPLTHNIAHNPYPSHS 351 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 622 FREHPPRSVAEDGQERR 672 ++EH RS+ E G RR Sbjct: 573 YKEHIMRSITESGGRRR 589 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 7.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 641 RGGCSRKPGMVWIRTLAASMATGRCRR*IPPTQTPP 534 R G R P + IR + A TG+ + IPP P Sbjct: 1748 RCGEGRHPLLTTIRNVLADAGTGQ-QETIPPIDEEP 1782 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.0 bits (42), Expect = 9.5 Identities = 10/39 (25%), Positives = 20/39 (51%) Frame = -3 Query: 278 VGQTA*QNPPTPQRAKYLGDPNSQDSVGTAADAAMPPVC 162 + +T QN ++ +PN DS+ A++A+ +C Sbjct: 508 LSETFTQNLSLMDESEGRQEPNMTDSLTRLANSALDNIC 546 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 Query: 504 TATLTVPSCTWRRLRRRNSSP 566 TAT+ + +CT L+ +SP Sbjct: 247 TATVQLSTCTRTTLKNNRASP 267 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,968 Number of Sequences: 336 Number of extensions: 3444 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -