BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021290 (656 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 24 0.96 AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 24 1.3 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 1.7 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 23 2.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.1 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 6.7 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 6.7 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 24.2 bits (50), Expect = 0.96 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +2 Query: 299 GDPKSDGKAITLSQSDKWMKQAKVIDGKKITTTDTAIHFKKLKSVKLGID 448 GDP +TL D W++ + + + I T + F +K G+D Sbjct: 21 GDPTERDLIVTLDDRDLWLR-FECLTNEMIVTKNGRRMFPVVKVTAAGLD 69 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 23.8 bits (49), Expect = 1.3 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +3 Query: 201 ENGNAPGASNGTSSKSEDTPYLSRKPSRRFP 293 E +P G KSED P +S K P Sbjct: 202 EQSLSPDTVFGDDGKSEDVPVISLKNENELP 232 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.4 bits (48), Expect = 1.7 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +2 Query: 314 DGKAITLSQSDKWMKQAKVIDGKKITTTDTAIH-FKKLKSVKLGIDDYQKFLDDLAKNKK 490 D + + L+ S + ++Q K++ + + F++L K D Y+KF + +KN K Sbjct: 379 DSEDLPLNISREMLQQNKILKVIRKNLVKKCLELFEELAEDK---DGYKKFYEQFSKNIK 435 Query: 491 VELDE 505 + + E Sbjct: 436 LGIHE 440 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.6 bits (46), Expect = 2.9 Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = -3 Query: 408 IAVSVVVIFFPSITLACFIHLSLCESVMAFPSDLGS--PNLENALKASLKDKAYPRFYWT 235 I + +V++FF +L CF + + + NLE+ K K K Y +Y+ Sbjct: 61 IHIKIVLMFFKEASLYCFNYYVIVVTTFYKRRTWTRLLKNLESCAKIK-KTKRYCYYYYA 119 Query: 234 F 232 F Sbjct: 120 F 120 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 478 REII*KLLVVVDAEFYRFE 422 R + K L VVD ++Y FE Sbjct: 594 RRVAQKYLRVVDPDYYEFE 612 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 478 REII*KLLVVVDAEFYRFE 422 R + K L VVD ++Y FE Sbjct: 594 RRVAQKYLRVVDPDYYEFE 612 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 478 REII*KLLVVVDAEFYRFE 422 R + K L VVD ++Y FE Sbjct: 594 RRVAQKYLRVVDPDYYEFE 612 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 478 REII*KLLVVVDAEFYRFE 422 R + K L VVD ++Y FE Sbjct: 594 RRVAQKYLRVVDPDYYEFE 612 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 6.7 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +3 Query: 579 GRRSIDRHEQIY 614 GR+ + +H+QIY Sbjct: 23 GRKKLSKHQQIY 34 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 225 SNGTSSKSEDTPYLSRKPSRRFP 293 SNG + ED P +S S R P Sbjct: 900 SNGAKEEDEDKPSVSPLTSPRQP 922 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,807 Number of Sequences: 336 Number of extensions: 3145 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -