BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021289 (804 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 28 0.12 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 7.7 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 27.9 bits (59), Expect = 0.12 Identities = 17/84 (20%), Positives = 37/84 (44%), Gaps = 1/84 (1%) Frame = -3 Query: 775 GSSQLCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAG-VLNGDERFRH 599 G+ Q C +P S+ + L+ + + + Q NSP + P H+G + R Sbjct: 25 GTIQACTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSGSSASTSPAART 84 Query: 598 VTTLHAWNETPCARRYYRPRTASA 527 ++++ + A +++ + A A Sbjct: 85 TSSMYPYVSAAAAHHHHQQQQAVA 108 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.8 bits (44), Expect = 7.7 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 486 SDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSP 376 +D R SP TP+ + Y +E+ + S F D+P Sbjct: 21 NDKRIYLSPR--TPIKNVYKNNIETKNQLSPFNIDTP 55 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,725 Number of Sequences: 438 Number of extensions: 5382 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25489170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -