BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021286 (739 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47946| Best HMM Match : No HMM Matches (HMM E-Value=.) 151 6e-37 SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) 142 3e-34 SB_11655| Best HMM Match : No HMM Matches (HMM E-Value=.) 133 2e-31 SB_46129| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_53305| Best HMM Match : S-AdoMet_synt_N (HMM E-Value=0.0056) 85 7e-17 SB_16847| Best HMM Match : S-AdoMet_synt_M (HMM E-Value=0) 58 1e-08 SB_18815| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_31747| Best HMM Match : Myotub-related (HMM E-Value=0) 32 0.56 SB_15158| Best HMM Match : Cadherin (HMM E-Value=7.5e-23) 31 0.74 SB_17763| Best HMM Match : IBN_N (HMM E-Value=3.4e-20) 31 0.97 SB_29676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_43848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_21435| Best HMM Match : DUF846 (HMM E-Value=4.3e-35) 28 6.9 SB_58705| Best HMM Match : ABC_tran (HMM E-Value=5.7e-05) 28 9.1 SB_50759| Best HMM Match : PH (HMM E-Value=0.07) 28 9.1 >SB_47946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 460 Score = 151 bits (366), Expect = 6e-37 Identities = 66/85 (77%), Positives = 79/85 (92%) Frame = +2 Query: 254 TGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGV 433 TGM+++CGEITS ANVDYQKVVR+T+K IGYDDSSKGFDYKTC+V+ A++QQSP+IA GV Sbjct: 6 TGMIVVCGEITSLANVDYQKVVRDTIKQIGYDDSSKGFDYKTCTVLQAIEQQSPDIAQGV 65 Query: 434 HENRNDEEVGAGDQGLMFGYATDET 508 H R+DE++GAGDQGLMFGYATDET Sbjct: 66 HIGRSDEDLGAGDQGLMFGYATDET 90 Score = 103 bits (247), Expect = 2e-22 Identities = 46/75 (61%), Positives = 56/75 (74%) Frame = +1 Query: 511 ECMPLTVVLAHKLNQKIAELRRNGEFWWARPDSKTQVTCEYVFAGGATVPQRVHTVVVSL 690 E MPLTVVLAH LN+++A+ RRNG W RPDSKTQVT EY F GG VP RVHT+V+S+ Sbjct: 92 ELMPLTVVLAHGLNKRLADCRRNGSLPWVRPDSKTQVTVEYKFQGGKAVPLRVHTIVISV 151 Query: 691 QHSEKITLETLRDEI 735 QH I L+ +R E+ Sbjct: 152 QHDPNIELDVMRKEL 166 >SB_46130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 142 bits (344), Expect = 3e-34 Identities = 64/86 (74%), Positives = 75/86 (87%) Frame = +2 Query: 254 TGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGV 433 TGM+LLCGEITS A VDYQ VVR+ +K IGYDDS KGFDYKTC+V++AL+QQS +IA GV Sbjct: 75 TGMILLCGEITSNAVVDYQSVVRQCIKDIGYDDSEKGFDYKTCNVLVALEQQSVDIAHGV 134 Query: 434 HENRNDEEVGAGDQGLMFGYATDETK 511 H R +E+VGAGDQGLMFGYATDET+ Sbjct: 135 HVGREEEDVGAGDQGLMFGYATDETE 160 Score = 108 bits (260), Expect = 4e-24 Identities = 49/76 (64%), Positives = 59/76 (77%) Frame = +1 Query: 508 KECMPLTVVLAHKLNQKIAELRRNGEFWWARPDSKTQVTCEYVFAGGATVPQRVHTVVVS 687 +E MPLTVVLAHK+NQK+AE RR+G WARPDSKTQVT EY F G +P RVHT+V+S Sbjct: 160 EELMPLTVVLAHKMNQKLAEYRRDGTLPWARPDSKTQVTVEYKFEHGRAIPLRVHTIVIS 219 Query: 688 LQHSEKITLETLRDEI 735 +QH IT+E LR E+ Sbjct: 220 VQHDPTITMENLRKEL 235 Score = 91.9 bits (218), Expect = 5e-19 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 117 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITK 254 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVACET+ K Sbjct: 29 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVACETVAK 74 >SB_11655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 133 bits (321), Expect = 2e-31 Identities = 61/86 (70%), Positives = 71/86 (82%) Frame = +2 Query: 254 TGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGV 433 TG+VLL GEITS A VDYQ VVR T++ IGY+DSS GFDYKTCSV+LA+ +Q IA V Sbjct: 96 TGLVLLFGEITSNARVDYQAVVRNTIRDIGYNDSSTGFDYKTCSVLLAIQEQVAEIAQTV 155 Query: 434 HENRNDEEVGAGDQGLMFGYATDETK 511 H NR D+E+GAGDQGLMFGYATDET+ Sbjct: 156 HLNRRDDEIGAGDQGLMFGYATDETE 181 Score = 86.6 bits (205), Expect = 2e-17 Identities = 40/52 (76%), Positives = 41/52 (78%) Frame = +3 Query: 99 YDMEDGSVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITK 254 Y D FLFTSESV EGH DKMCDQISDA+LDAHL QDP AKVACET TK Sbjct: 44 YSTSDCDNFLFTSESVNEGHSDKMCDQISDAVLDAHLEQDPYAKVACETATK 95 Score = 81.0 bits (191), Expect = 9e-16 Identities = 36/77 (46%), Positives = 51/77 (66%) Frame = +1 Query: 508 KECMPLTVVLAHKLNQKIAELRRNGEFWWARPDSKTQVTCEYVFAGGATVPQRVHTVVVS 687 +E MPLT VLAHKL ++AE R+ W PD KTQVT +Y GA +P+RVHTV++S Sbjct: 181 EELMPLTTVLAHKLCARLAECRKGKILPWLLPDGKTQVTVDYRLERGACIPERVHTVLIS 240 Query: 688 LQHSEKITLETLRDEIR 738 QH+ + +E +R ++ Sbjct: 241 TQHTPDVGIEEIRHHLK 257 >SB_46129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 90.2 bits (214), Expect = 2e-18 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +3 Query: 117 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVACETITK 254 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVACE++ K Sbjct: 9 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVACESVAK 54 Score = 68.1 bits (159), Expect = 7e-12 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +2 Query: 254 TGMVLLCGEITSKANVDYQKVVRETVKHIGYDDSSK 361 TGM+++CGEITS ANVDYQKVVR+T+K IGYDDSSK Sbjct: 55 TGMIVVCGEITSLANVDYQKVVRDTIKQIGYDDSSK 90 >SB_53305| Best HMM Match : S-AdoMet_synt_N (HMM E-Value=0.0056) Length = 70 Score = 84.6 bits (200), Expect = 7e-17 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 117 SVFLFTSESVGEGHPDKMCDQISDAILDAHLNQDPDAKVAC 239 + FLFTSESVGEGHPDKMCDQISDAILDAHL QDP+AKVAC Sbjct: 29 NTFLFTSESVGEGHPDKMCDQISDAILDAHLKQDPNAKVAC 69 >SB_16847| Best HMM Match : S-AdoMet_synt_M (HMM E-Value=0) Length = 192 Score = 57.6 bits (133), Expect = 1e-08 Identities = 31/73 (42%), Positives = 45/73 (61%) Frame = +1 Query: 517 MPLTVVLAHKLNQKIAELRRNGEFWWARPDSKTQVTCEYVFAGGATVPQRVHTVVVSLQH 696 MP V AH+L ++ +ELRRNG W RPD+K+QVT + G + +V VV+S QH Sbjct: 30 MPAPVYYAHRLVERQSELRRNGTLPWLRPDAKSQVTINW--EGDS---PKVDAVVLSTQH 84 Query: 697 SEKITLETLRDEI 735 I+L+ LR+ + Sbjct: 85 DPSISLDDLREAV 97 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +2 Query: 452 EEVGAGDQGLMFGYATDET 508 E+ GAGDQGLMFGYAT+ET Sbjct: 8 EDQGAGDQGLMFGYATNET 26 >SB_18815| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +1 Query: 1 RGTVWGYISGLTLNSECRRLQK*MDTRK-PTDTVMIWKMDQYFCSH 135 RG VW ++GL+ N E K + T++ PT+ V++W + + F +H Sbjct: 416 RGQVWQMMAGLSENDELVDSYKHLFTKESPTEQVIVWDIHRTFPAH 461 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +1 Query: 1 RGTVWGYISGLTLNSECRRLQK*MDTRK-PTDTVMIWKMDQYFCSH 135 RG VW ++GL+ N E K + T++ PT+ V++W + + F +H Sbjct: 70 RGQVWQMMAGLSENDELVDSYKHLFTKESPTEQVIVWDIHRTFPAH 115 >SB_31747| Best HMM Match : Myotub-related (HMM E-Value=0) Length = 550 Score = 31.9 bits (69), Expect = 0.56 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -1 Query: 310 LIIHVSFGCDFATQ--KHHTGLVMVSHATFASGS*FRCASRIASLIWSHILSG 158 L H++F C + H +S + A + FRC+ R S++W H+ +G Sbjct: 263 LTCHLNFACRVCRTYPRLHVIPSSISDSDLAKVASFRCSGRFPSIVWRHMTNG 315 >SB_15158| Best HMM Match : Cadherin (HMM E-Value=7.5e-23) Length = 390 Score = 31.5 bits (68), Expect = 0.74 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 3/37 (8%) Frame = +2 Query: 275 GEITSKANVDYQKVVRETV---KHIGYDDSSKGFDYK 376 GEITS N+D +K+ + K I YD G+DY+ Sbjct: 103 GEITSNVNIDREKLPGSNLLEFKAIAYDAKGAGYDYR 139 >SB_17763| Best HMM Match : IBN_N (HMM E-Value=3.4e-20) Length = 681 Score = 31.1 bits (67), Expect = 0.97 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 497 LHNRTSSPGLLPQLPRHFCSHAPQQQCLVIVGL 399 L N T+ P + PQ P H SHA + ++I G+ Sbjct: 99 LGNETARPAIAPQEPEHLVSHANKILTVIIQGM 131 >SB_29676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 147 GEGHPDKMCDQISDAILDAHLNQDPDAKVACETITKPVWCFCVAKSHPKL 296 G G D++ + +L A +N A T TKPV + +A HP++ Sbjct: 391 GLGRLDRLVEAFVYTVLGAQVNVRSSIANAINTETKPVGAYNMAGGHPRV 440 >SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1155 Score = 28.7 bits (61), Expect = 5.2 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +3 Query: 48 MPETSKMNGYAKTNGHSYDMEDGSVFLFTSESVGE-GHPDKMCDQISDAILDAHLNQDPD 224 MP G +K N + D D +L +S+ + D++C + I AHL QDPD Sbjct: 196 MPYGGGKRGKSKKNSSTLDTGDLETWLKGRKSITRVRNHDELCAARALVIGMAHLTQDPD 255 >SB_43848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 28.3 bits (60), Expect = 6.9 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -3 Query: 515 HSLSHLLHNRTSSPGLLPQLPRHFCSHAPQQQCLVIVGLVRASHCMS 375 H +SH L + P ++ H SH P CL I+G + H +S Sbjct: 325 HRVSHFLSSGIPLP-IIGLSSHHRVSHFPSSGCLPIIGYPTSHHRVS 370 >SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 28.3 bits (60), Expect = 6.9 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +3 Query: 48 MPETSKMNGYAKTNGHSYDMEDGSVFLFTSESVGE-GHPDKMCDQISDAILDAHLNQDPD 224 MP + G +K N + D D +L S+ + D++C + I AHL +DPD Sbjct: 241 MPFGAGKRGKSKKNSSTLDTGDLETWLKGKRSITRVRNHDELCAARATVIGMAHLTKDPD 300 >SB_21435| Best HMM Match : DUF846 (HMM E-Value=4.3e-35) Length = 323 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 331 DRFAHNFLIIHVSFGCDFATQKHHTGLVMV 242 D F NF++I + CDF T K+ +G ++V Sbjct: 208 DSFITNFVVIVLLLSCDFWTVKNVSGRLLV 237 >SB_58705| Best HMM Match : ABC_tran (HMM E-Value=5.7e-05) Length = 284 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/61 (24%), Positives = 33/61 (54%) Frame = +1 Query: 451 RGSWGRRPGLDVRLCNR*DKECMPLTVVLAHKLNQKIAELRRNGEFWWARPDSKTQVTCE 630 +GS G +PG D R ++ D+E P +++ ++++ + + N F + + +VT E Sbjct: 39 QGSAGEKPGTDSRKSSKMDQENRPEAILVHNEVHPESDKETHNPGFARSLSTRERRVTLE 98 Query: 631 Y 633 + Sbjct: 99 W 99 >SB_50759| Best HMM Match : PH (HMM E-Value=0.07) Length = 320 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +3 Query: 216 DPDAKVACETITKPVWCFCVAKSHPKLTWIIKKLCAKRSNI 338 DPD + C+ +T+P+ + +A SH T+++ + RS+I Sbjct: 265 DPDQQNICQDMTQPLSHYFIASSHN--TYLLDNQLSGRSSI 303 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,506,502 Number of Sequences: 59808 Number of extensions: 590608 Number of successful extensions: 1720 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1719 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -