BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021285 (750 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) 31 1.3 SB_57666| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 >SB_25408| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1636 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/94 (23%), Positives = 43/94 (45%) Frame = -1 Query: 390 LQTSFLVTSSLKSLNY*IFNKFTIVFYSLRNKTILFK*FRRDFVGTFFPKYLNRMSKYVL 211 L S L+T + L + + +++++ ++ +LF D+ G+ + R++ L Sbjct: 1370 LVVSLLLTGQVDKLTKNL-SILPVLWHTNKSLVLLFTWSSSDYQGSLIILFTARLNSRFL 1428 Query: 210 MTYFKVVFMISVMINRFRQRMDFSDEGSIMNLNT 109 M Y K + + I R Q FS G+ L+T Sbjct: 1429 MVYIKGFAIALMNIKRVNQSHRFSSGGNKRKLST 1462 >SB_57666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = -2 Query: 542 NCFADSNILPQPPQGSAPHHLNHFRLRVIQIL 447 N AD N LP PP P +NHFRL +IL Sbjct: 325 NRHADDNWLP-PPSILVPRAINHFRLCSAKIL 355 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,532,868 Number of Sequences: 59808 Number of extensions: 384008 Number of successful extensions: 887 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 887 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -