BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021285 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 27 0.82 Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein... 23 7.6 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 26.6 bits (56), Expect = 0.82 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +3 Query: 60 YFIGSQESRCPKTIIYMYLNSLWSPHPKNPFSVG 161 Y G + CP IY N W P+P ++ G Sbjct: 225 YDDGVCKQECPPMQIYNPTNYFWEPNPDGKYAYG 258 >Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein protein. Length = 401 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 438 KGPREKKNTYRTFIH*LQT 382 K R NTYRT++H ++T Sbjct: 368 KKDRWNTNTYRTYLHMIKT 386 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 713,967 Number of Sequences: 2352 Number of extensions: 12744 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -