BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021284 (469 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_328| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_33687| Best HMM Match : Filament (HMM E-Value=0.1) 40 0.001 SB_35536| Best HMM Match : zf-C2H2 (HMM E-Value=0.0069) 39 0.002 SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_54719| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.045) 34 0.051 SB_33753| Best HMM Match : bZIP_Maf (HMM E-Value=2.3) 33 0.12 SB_17390| Best HMM Match : Exo_endo_phos (HMM E-Value=3.1e-13) 33 0.16 SB_34623| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_30701| Best HMM Match : Lipase_GDSL (HMM E-Value=0.022) 33 0.16 SB_29903| Best HMM Match : SAP (HMM E-Value=2.2e-11) 33 0.16 SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.16 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 32 0.21 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 32 0.27 SB_21535| Best HMM Match : Band_41 (HMM E-Value=3.7e-24) 31 0.36 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 31 0.36 SB_38304| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.39) 31 0.36 SB_36542| Best HMM Match : Pox_A_type_inc (HMM E-Value=7.3e-11) 31 0.36 SB_8075| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_7216| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.48 SB_36367| Best HMM Match : UVR (HMM E-Value=1.2) 31 0.63 SB_25340| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.83 SB_27989| Best HMM Match : Involucrin2 (HMM E-Value=1.2) 30 0.83 SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17) 30 0.83 SB_9039| Best HMM Match : M (HMM E-Value=0.00046) 30 0.83 SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) 29 1.5 SB_45073| Best HMM Match : ERM (HMM E-Value=0) 29 1.5 SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) 29 1.5 SB_20440| Best HMM Match : SRP-alpha_N (HMM E-Value=1.4) 29 1.9 SB_7462| Best HMM Match : PspA_IM30 (HMM E-Value=0.15) 29 1.9 SB_2262| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_52938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_9579| Best HMM Match : 7kD_DNA_binding (HMM E-Value=4.6) 29 1.9 SB_55799| Best HMM Match : Na_trans_assoc (HMM E-Value=1.5) 29 2.5 SB_46713| Best HMM Match : GrpE (HMM E-Value=1.7) 29 2.5 SB_31642| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) 29 2.5 SB_33903| Best HMM Match : GrpE (HMM E-Value=1.7) 29 2.5 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_25353| Best HMM Match : Vicilin_N (HMM E-Value=3.5) 29 2.5 SB_15698| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_12666| Best HMM Match : DUF349 (HMM E-Value=5.2) 29 2.5 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_867| Best HMM Match : Leo1 (HMM E-Value=0) 29 2.5 SB_46683| Best HMM Match : F5_F8_type_C (HMM E-Value=9.6e-12) 28 3.4 SB_24434| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_22025| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.12) 28 3.4 SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) 28 3.4 SB_19362| Best HMM Match : M (HMM E-Value=0.0014) 28 3.4 SB_2332| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_37641| Best HMM Match : WXG100 (HMM E-Value=2) 28 4.4 SB_36871| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_34460| Best HMM Match : Borrelia_orfA (HMM E-Value=0.3) 28 4.4 SB_30230| Best HMM Match : CH (HMM E-Value=0.0035) 28 4.4 SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) 28 4.4 SB_12816| Best HMM Match : PDT (HMM E-Value=0.7) 28 4.4 SB_12581| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_56887| Best HMM Match : TolA (HMM E-Value=0.66) 28 4.4 SB_57289| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.037) 27 5.9 SB_52725| Best HMM Match : WD40 (HMM E-Value=2.1e-22) 27 5.9 SB_45648| Best HMM Match : WD40 (HMM E-Value=2.4e-14) 27 5.9 SB_33387| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 27 5.9 SB_27687| Best HMM Match : zf-B_box (HMM E-Value=6.7e-10) 27 5.9 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_3563| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_38638| Best HMM Match : zf-B_box (HMM E-Value=6.8e-18) 27 5.9 SB_37165| Best HMM Match : SH3_1 (HMM E-Value=0) 27 5.9 SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_592| Best HMM Match : DUF1279 (HMM E-Value=0.68) 27 5.9 SB_53689| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_46204| Best HMM Match : bZIP_2 (HMM E-Value=1.8) 27 7.7 SB_41792| Best HMM Match : DUF495 (HMM E-Value=1.5) 27 7.7 SB_23626| Best HMM Match : WXG100 (HMM E-Value=2) 27 7.7 SB_22823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_21353| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_20871| Best HMM Match : Cauli_DNA-bind (HMM E-Value=0.99) 27 7.7 SB_14736| Best HMM Match : Exonuc_VII_S (HMM E-Value=1.2) 27 7.7 SB_5091| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_3093| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_2658| Best HMM Match : CHASE3 (HMM E-Value=5.8) 27 7.7 SB_58004| Best HMM Match : WXG100 (HMM E-Value=2) 27 7.7 SB_57509| Best HMM Match : WXG100 (HMM E-Value=2) 27 7.7 SB_46219| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_37766| Best HMM Match : IncA (HMM E-Value=0.4) 27 7.7 SB_34971| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_34096| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_23474| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12) 27 7.7 SB_19224| Best HMM Match : G5 (HMM E-Value=2.2) 27 7.7 SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 SB_15583| Best HMM Match : WXG100 (HMM E-Value=2) 27 7.7 SB_15139| Best HMM Match : Collagen (HMM E-Value=0.27) 27 7.7 >SB_328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 44.4 bits (100), Expect = 5e-05 Identities = 19/56 (33%), Positives = 32/56 (57%) Frame = +1 Query: 262 EDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVR 429 ED + +K Q++ +K DF ER R+ + EKE + +L Q + LTQ+++ R Sbjct: 188 EDLDHVKIQMQQFKEDFSCERRDRERVQKEKECIQAELANAQEIIATLTQEVEMYR 243 >SB_33687| Best HMM Match : Filament (HMM E-Value=0.1) Length = 700 Score = 39.5 bits (88), Expect = 0.001 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +1 Query: 265 DTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQL 417 + E+LK QL +Y DF +ER+ R+ + +EKE + L+ + L +Q+ Sbjct: 519 EIEVLKQQLRVYADDFTSERQDRERVQAEKEKISEQLKAVKEQVLALEEQV 569 Score = 39.5 bits (88), Expect = 0.001 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +1 Query: 265 DTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQL 417 + ++LK QL +Y DF +ER+ R+ + +EKE + L+ + L +QL Sbjct: 566 EEQVLKQQLRVYADDFTSERQDRERVQAEKEKISEQLKAVKEQVLALEEQL 616 Score = 27.5 bits (58), Expect = 5.9 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 259 KEDTELLKAQLELYKSDFEAERESRQEM 342 KE L+ QL +Y+ DF ER+ ++ + Sbjct: 606 KEQVLALEEQLRIYEEDFRRERQEKERL 633 >SB_35536| Best HMM Match : zf-C2H2 (HMM E-Value=0.0069) Length = 657 Score = 38.7 bits (86), Expect = 0.002 Identities = 21/61 (34%), Positives = 34/61 (55%) Frame = +1 Query: 274 LLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSDVYQ 453 +L+ Q++ Y+ DF AERE+R+ +E ++ + Q NQEL +LD V + Q Sbjct: 463 MLEQQVKAYQEDFNAEREAREAKNTELLSLRERVDHLQFENQELRAELDNVNQEQMAEMQ 522 Query: 454 R 456 R Sbjct: 523 R 523 >SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1507 Score = 35.5 bits (78), Expect = 0.022 Identities = 14/51 (27%), Positives = 29/51 (56%) Frame = +1 Query: 259 KEDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQ 411 K++ LLK +L+ K + +RE ++ S + ++ D + Q++N LT+ Sbjct: 1136 KQELALLKTKLKKVKEELARQREQNTDLLSRSQKMMVDELEVQKLNNSLTE 1186 >SB_54719| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.045) Length = 782 Score = 34.3 bits (75), Expect = 0.051 Identities = 15/61 (24%), Positives = 38/61 (62%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSDVY 450 ++ K +L++ + + S++E+ SEK TD +K + ++++++ +E+RRL +++ Sbjct: 296 QMNKERLQIERKLANFTKTSKKEVESEKVISRTDGKKVLELEKDISKKKNEIRRLRTELS 355 Query: 451 Q 453 Q Sbjct: 356 Q 356 >SB_33753| Best HMM Match : bZIP_Maf (HMM E-Value=2.3) Length = 223 Score = 33.1 bits (72), Expect = 0.12 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +1 Query: 259 KEDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLN 438 KE+ L+ +L L KSD + RE R + + DL K N+ +Q D+V LN Sbjct: 26 KEENGYLREELRLIKSDMDQIREERDSLKLVVSMLTKDLYKNHPDNKPSSQ--DQVLDLN 83 Query: 439 SD 444 D Sbjct: 84 CD 85 >SB_17390| Best HMM Match : Exo_endo_phos (HMM E-Value=3.1e-13) Length = 851 Score = 32.7 bits (71), Expect = 0.16 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +1 Query: 259 KEDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLN 438 KE+ L+ +L L KSD + RE R + + DL K N+ +Q D+V LN Sbjct: 55 KEENGYLREELRLIKSDMDKIREERDSLKLVVSMLSKDLYKNHPDNKPSSQ--DQVLDLN 112 Query: 439 SD 444 D Sbjct: 113 CD 114 >SB_34623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 553 Score = 32.7 bits (71), Expect = 0.16 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRR 432 +L + Q+E E + QEM +EKE +L KTQ+ ++ + L++ R Sbjct: 156 QLSRLQVEFDAKSTELANKHAQEMTAEKERILHQKSKTQQQYEKERRDLEQAHR 209 >SB_30701| Best HMM Match : Lipase_GDSL (HMM E-Value=0.022) Length = 297 Score = 32.7 bits (71), Expect = 0.16 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +1 Query: 259 KEDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLN 438 KE+ L+ +L L KSD + RE R + + DL K N+ +Q D+V LN Sbjct: 26 KEENGYLREELRLIKSDMDKIREERDSLKLVVSMLSKDLYKNHPDNKPSSQ--DQVLDLN 83 Query: 439 SD 444 D Sbjct: 84 CD 85 >SB_29903| Best HMM Match : SAP (HMM E-Value=2.2e-11) Length = 510 Score = 32.7 bits (71), Expect = 0.16 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +1 Query: 259 KEDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLN 438 KE+ L+ +L L KSD + RE R + + DL K N+ +Q D+V LN Sbjct: 189 KEENGYLREELRLIKSDMDKIREERDSLKLVVSMLSKDLYKNHPDNKPSSQ--DQVLDLN 246 Query: 439 SD 444 D Sbjct: 247 CD 248 >SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1821 Score = 32.7 bits (71), Expect = 0.16 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +1 Query: 259 KEDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLN 438 KE+ L+ +L L KSD + RE R + + DL K N+ +Q D+V LN Sbjct: 189 KEENGYLREELRLIKSDMDKIREERDSLKLVVSMLSKDLYKNHPDNKPSSQ--DQVLDLN 246 Query: 439 SD 444 D Sbjct: 247 CD 248 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 32.3 bits (70), Expect = 0.21 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = +1 Query: 277 LKAQLELYKS-DFEAERESRQEMASEKETVLTD-LRKTQRMNQELTQQLDEVR 429 LKA LE + +++ ERE E+A + VL D L KTQ+ + +QLDE R Sbjct: 1430 LKATLEKSEEVNYDLEREL--EVAKRRVMVLEDQLTKTQKQRTQCNEQLDETR 1480 Score = 29.5 bits (63), Expect = 1.5 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = +1 Query: 301 KSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNS 441 +S + +++ +++ + LR+TQ N+ LT+Q++EV R S Sbjct: 1028 QSQVDNQQKQLKQVQQRLDNTYEALRRTQDENRNLTEQIEEVSREGS 1074 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 31.9 bits (69), Expect = 0.27 Identities = 19/64 (29%), Positives = 32/64 (50%) Frame = +1 Query: 277 LKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSDVYQR 456 L A LE Y+SDF R+ R + + T + + + N EL +L EV+ + +R Sbjct: 4188 LSASLEKYQSDFNHTRQERDKYQTANYTYNREKEELAQQNAELKMKL-EVKVNECEELER 4246 Query: 457 ATAN 468 T++ Sbjct: 4247 TTSD 4250 >SB_21535| Best HMM Match : Band_41 (HMM E-Value=3.7e-24) Length = 2278 Score = 31.5 bits (68), Expect = 0.36 Identities = 25/96 (26%), Positives = 44/96 (45%) Frame = +2 Query: 104 GIFKDCSNILDSKAKEAKNPGTPNIEMLTSALVARGQELQMLKVEIDKLKGRKRTRSF*K 283 G+ ++ + +++ K NPG PN + A VA+G Q L ++ L G++ K Sbjct: 1105 GVIQESAKLINEAKKALNNPGDPNNQQ-RLAQVAKGVS-QALNNCVNCLPGQREVEDSIK 1162 Query: 284 HNSNCTRATSKRNESLVKRWPAKRRPCSRTSGKLNE 391 S ++A SK + +P P R KL++ Sbjct: 1163 AVSAASQALSK------EEFPPTTEPYQRNQEKLSQ 1192 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 31.5 bits (68), Expect = 0.36 Identities = 17/68 (25%), Positives = 33/68 (48%) Frame = +1 Query: 262 EDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNS 441 +DT+LL A+L + DFE + + ++ASE +L+ + L Q + ++ Sbjct: 73 KDTDLLNARLTKVQQDFEQQLMNCDQLASENTQKAAELKAKEDEINTLKQDTVRLTKMRE 132 Query: 442 DVYQRATA 465 + +R A Sbjct: 133 AIQRRLRA 140 >SB_38304| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.39) Length = 704 Score = 31.5 bits (68), Expect = 0.36 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 289 LELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRR 432 L L D + ++ E E + +DLR +N+ L+QQL E RR Sbjct: 5 LALQIQDLHQSIQRFGSISDEAERLRSDLRDAHALNENLSQQLQETRR 52 >SB_36542| Best HMM Match : Pox_A_type_inc (HMM E-Value=7.3e-11) Length = 1500 Score = 31.5 bits (68), Expect = 0.36 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 289 LELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRR 432 L L D + ++ E E + +DLR +N+ L+QQL E RR Sbjct: 1225 LALQIQDLHQSIQRFGSISDEAERLRSDLRDAHALNENLSQQLQETRR 1272 >SB_8075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 31.1 bits (67), Expect = 0.48 Identities = 18/54 (33%), Positives = 32/54 (59%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRR 432 E LKA+L +++ E+++E +EM K+ + K +R NQEL + + VR+ Sbjct: 2 EDLKAKLTKKENEIESKKEEMEEM---KDALDKMAIKLERQNQELQEAMQRVRQ 52 >SB_7216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1400 Score = 31.1 bits (67), Expect = 0.48 Identities = 17/54 (31%), Positives = 29/54 (53%) Frame = +1 Query: 262 EDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 + +L K + +SD E ++ EMAS + +DL + NQ+L +QL+E Sbjct: 832 QSQDLPKNESSTTESDSEKLEKALAEMASRARSAESDLAFVEAENQDLLKQLEE 885 >SB_36367| Best HMM Match : UVR (HMM E-Value=1.2) Length = 169 Score = 30.7 bits (66), Expect = 0.63 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = +1 Query: 343 ASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSDVYQRA 459 ASEKET ++ Q +EL ++LD++++L S + +A Sbjct: 70 ASEKETPEQKYQRLQHEMRELAEELDQIKKLPSKLVHQA 108 >SB_25340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1105 Score = 30.7 bits (66), Expect = 0.63 Identities = 18/56 (32%), Positives = 29/56 (51%) Frame = +1 Query: 274 LLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNS 441 L +A+L LYK E + R + S+ T L ++ ++ T+Q +VRR NS Sbjct: 403 LERAELNLYKQRLEKALQERANLTSKLRT----LSRSLSAREDSTEQAPQVRRANS 454 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 30.7 bits (66), Expect = 0.63 Identities = 15/58 (25%), Positives = 30/58 (51%) Frame = +1 Query: 292 ELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSDVYQRATA 465 ++ F +R + + EKE +L L+ Q L QL+++++ N+D Y++ A Sbjct: 1669 DIANQKFVEQRTDNEVLKEEKEKLLMQLKDLQNEVARLENQLEDLKKRNAD-YEKLLA 1725 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 30.3 bits (65), Expect = 0.83 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 4/65 (6%) Frame = +2 Query: 11 GLAELKQQLEKQHSAVLSNIGQVRGTLSIFEGIFKD---CSNILDSKAKEAK-NPGTPNI 178 GLA +K++++KQ + +I +V G S+F + S ++ KE K + G N Sbjct: 734 GLARVKEEMKKQKIEAVFSIAEVSGKCSVFGSSSTEADKASEVVTKLIKEVKIDVGKDNQ 793 Query: 179 EMLTS 193 ++L S Sbjct: 794 DLLAS 798 >SB_27989| Best HMM Match : Involucrin2 (HMM E-Value=1.2) Length = 192 Score = 30.3 bits (65), Expect = 0.83 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +1 Query: 286 QLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLN 438 QL L + ERE Q++ +EK+ +L D + Q++ +E ++E R LN Sbjct: 102 QLRLREEGERQERERLQKLVAEKDKLLEDAQ--QKLAEERLAMVEERRTLN 150 >SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17) Length = 1775 Score = 30.3 bits (65), Expect = 0.83 Identities = 19/75 (25%), Positives = 38/75 (50%) Frame = +2 Query: 86 TLSIFEGIFKDCSNILDSKAKEAKNPGTPNIEMLTSALVARGQELQMLKVEIDKLKGRKR 265 T+S+ E K+ +L KA + K G + T+ + + + + KVE D +KGR++ Sbjct: 333 TISVQENALKEELKLLQQKANKVK--GKIHELKTTNVKLVKPKNILGAKVEHDSVKGRQK 390 Query: 266 TRSF*KHNSNCTRAT 310 + H S+ + ++ Sbjct: 391 GKGNTTHQSHASTSS 405 >SB_9039| Best HMM Match : M (HMM E-Value=0.00046) Length = 716 Score = 30.3 bits (65), Expect = 0.83 Identities = 18/72 (25%), Positives = 38/72 (52%), Gaps = 7/72 (9%) Frame = +1 Query: 259 KEDTELLKAQLELYKSDFEAERE-------SRQEMASEKETVLTDLRKTQRMNQELTQQL 417 ++D E + +L+ KS+FEAERE + E +E+ T ++L + QR +++ Sbjct: 536 EKDVEKKRKKLDEEKSNFEAEREQLNDNRRALSENTAEEATAGSNLEEIQRKINRSREEM 595 Query: 418 DEVRRLNSDVYQ 453 ++ R ++ + Sbjct: 596 QQIERRKKELQE 607 >SB_44315| Best HMM Match : M (HMM E-Value=2.2e-10) Length = 2155 Score = 29.5 bits (63), Expect = 1.5 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = +1 Query: 262 EDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLR-KTQRMNQELTQQLDEVRRLN 438 E ELLK+QLE K +E+ + + L DLR K +++ ++L+Q+ ++++ + Sbjct: 135 EGEELLKSQLEAAKQFYES-------ASRDLNVTLDDLRSKNEQLQRQLSQKDNQLQSMK 187 Query: 439 SDV 447 DV Sbjct: 188 EDV 190 >SB_45073| Best HMM Match : ERM (HMM E-Value=0) Length = 504 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/57 (29%), Positives = 30/57 (52%) Frame = +1 Query: 259 KEDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVR 429 +E+ +K +LE + E RE ++ E+E +TQR+ +E + LDE+R Sbjct: 335 QEEERRIKEELEKERKLIEQNRELLEKRVQEQEA------ETQRLQEEFERALDELR 385 >SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 1997 Score = 29.5 bits (63), Expect = 1.5 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Frame = +1 Query: 280 KAQLELYK---SDFEAERESRQEMASEKETVLTDLRKTQRMN-QELTQQLDEVRR 432 +AQ+EL K SD R+ +E A E + +R Q QE+ ++LD+V++ Sbjct: 1194 QAQMELNKKRESDIIKLRKDLEEQALAHEQAVNSMRSKQNQQMQEMQEELDQVKK 1248 >SB_20440| Best HMM Match : SRP-alpha_N (HMM E-Value=1.4) Length = 526 Score = 29.1 bits (62), Expect = 1.9 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 289 LELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQL 417 +E + +AE+ESR E A ++ + LRK +LTQ L Sbjct: 474 VEFLREKAKAEQESRTEQARQQSLQMELLRKQSEGQMQLTQAL 516 >SB_7462| Best HMM Match : PspA_IM30 (HMM E-Value=0.15) Length = 393 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/66 (24%), Positives = 32/66 (48%) Frame = +1 Query: 259 KEDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLN 438 K+ L + E +++ E ++ +E V TD K + +N++L QQL + + + Sbjct: 243 KKKLHTLTMESERLRTEIGQRNELLFKIDAETNLVQTDREKAELLNEKLKQQLADYKVPD 302 Query: 439 SDVYQR 456 + Y R Sbjct: 303 NSQYSR 308 >SB_2262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 688 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +2 Query: 17 AELKQQLEKQHSAVLSNIGQVRGTLSIFEGIFKDCSNILDSKAKEAKNP 163 ++ + EK+ LS +G + LS +GI CS LD+ + ++P Sbjct: 207 SKAQSSTEKRGEKTLSKVGNIDAVLSEEDGIDLMCSETLDTPITQNQSP 255 >SB_52938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 29.1 bits (62), Expect = 1.9 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 289 LELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQL 417 +E + +AE+ESR E A ++ + LRK +LTQ L Sbjct: 151 VEFLREKAKAEQESRTEQARQQSLQMELLRKQSEGQMQLTQAL 193 >SB_9579| Best HMM Match : 7kD_DNA_binding (HMM E-Value=4.6) Length = 87 Score = 29.1 bits (62), Expect = 1.9 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 289 LELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQL 417 +E + +AE+ESR E A ++ + LRK +LTQ L Sbjct: 36 VEFLREKAKAEQESRTEQARQQSLQMELLRKQSEGQMQLTQAL 78 >SB_55799| Best HMM Match : Na_trans_assoc (HMM E-Value=1.5) Length = 577 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/60 (28%), Positives = 34/60 (56%) Frame = +1 Query: 265 DTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSD 444 ++ELL++Q EL S+F ES + +E+E Q++++E Q+ + +RR + + Sbjct: 384 ESELLESQPELLDSEFHGYDESLDPVPNEEEAA----EYEQQLHEENEQEEELLRRFSRE 439 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/60 (28%), Positives = 34/60 (56%) Frame = +1 Query: 265 DTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSD 444 ++ELL++Q EL S+F ES + +E+E Q++++E Q+ + +RR + + Sbjct: 445 ESELLESQPELLDSEFHGYDESLDPVPNEEEAA----EYEQQLHEENEQEEELLRRFSRE 500 >SB_46713| Best HMM Match : GrpE (HMM E-Value=1.7) Length = 420 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/60 (28%), Positives = 34/60 (56%) Frame = +1 Query: 265 DTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSD 444 ++ELL++Q EL S+F ES + +E+E Q++++E Q+ + +RR + + Sbjct: 215 ESELLESQHELLDSEFHGYDESLDPVPNEEEAA----EYEQQLHEENEQEEELLRRFSRE 270 >SB_31642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/52 (28%), Positives = 30/52 (57%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEV 426 ELLK Q E Y+S + ER + + + + + + + + ++N+EL +LD + Sbjct: 90 ELLKLQEE-YESSLQRERTACERLQTVHKEADSKIYRLSQVNEELKAELDSL 140 >SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) Length = 1078 Score = 28.7 bits (61), Expect = 2.5 Identities = 21/88 (23%), Positives = 38/88 (43%) Frame = +1 Query: 181 DADLGACGPRTXXXXXXXXXXXXXXXKEDTELLKAQLELYKSDFEAERESRQEMASEKET 360 D + A PR ++ELL++Q EL S+F ES + +E+E Sbjct: 347 DDETAANNPRQRSISESGELSQSSSFDSESELLESQHELLDSEFHGYDESLDPVPNEQEA 406 Query: 361 VLTDLRKTQRMNQELTQQLDEVRRLNSD 444 Q++ +E Q+ + +RR + + Sbjct: 407 A----EYEQQLREENEQEEELLRRFSRE 430 >SB_33903| Best HMM Match : GrpE (HMM E-Value=1.7) Length = 227 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/60 (28%), Positives = 34/60 (56%) Frame = +1 Query: 265 DTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSD 444 ++ELL++Q EL S+F ES + +E+E Q++++E Q+ + +RR + + Sbjct: 22 ESELLESQHELLDSEFHGYDESLDPVPNEEEAA----EYEQQLHEENEQEEELLRRFSRE 77 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVR 429 ELLKA +E K ESR ++ SE ++ + + + N+ ++ D +R Sbjct: 2282 ELLKADIEALKESNRGMEESRTKIESEIKSTKAKMCEMEITNEAYKEENDRLR 2334 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/62 (19%), Positives = 30/62 (48%) Frame = +1 Query: 259 KEDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLN 438 + D + + + K ++S Q+ + E + DL+ + + QE ++L+ ++ N Sbjct: 2643 QRDIDCMHREFAFLKDHLTNFKQSCQKQSDEIRRIKEDLKSKESLLQETKEELEALKEEN 2702 Query: 439 SD 444 S+ Sbjct: 2703 SE 2704 >SB_25353| Best HMM Match : Vicilin_N (HMM E-Value=3.5) Length = 306 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/60 (28%), Positives = 34/60 (56%) Frame = +1 Query: 265 DTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSD 444 ++ELL++Q EL S+F ES + +E+E Q++++E Q+ + +RR + + Sbjct: 113 ESELLESQPELLDSEFHGYDESLDPVPNEEEAA----EYEQQLHEENEQEEELLRRFSRE 168 >SB_15698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/60 (28%), Positives = 34/60 (56%) Frame = +1 Query: 265 DTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSD 444 ++ELL++Q EL S+F ES + +E+E Q++++E Q+ + +RR + + Sbjct: 22 ESELLESQPELLDSEFHGYDESLDPVPNEEEAA----EYEQQLHEENEQEEELLRRFSRE 77 >SB_12666| Best HMM Match : DUF349 (HMM E-Value=5.2) Length = 188 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 289 LELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQL 417 +E + +AE+ESR E A ++ + LRK +LTQ L Sbjct: 136 VEFLREKAKAEQESRTEQARQQSLQMELLRKQPEGQMQLTQAL 178 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/60 (28%), Positives = 34/60 (56%) Frame = +1 Query: 265 DTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSD 444 ++ELL++Q EL S+F ES + +E+E Q++++E Q+ + +RR + + Sbjct: 22 ESELLESQPELLDSEFHGYDESLDPVPNEEEAA----EYEQQLHEENEQEEELLRRFSRE 77 >SB_867| Best HMM Match : Leo1 (HMM E-Value=0) Length = 591 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/63 (23%), Positives = 31/63 (49%) Frame = +3 Query: 207 ADRSCRC*KLRSIS*RGERGHGAFESTTRTVQERLRSGTRVSSRDGQRKGDRAHGPQENS 386 ADR+ + K++ + G+ + +ERLRS R+ ++ + + RA+ +E+ Sbjct: 466 ADRALKAQKIKMLPAAGQDPEAQRSEMIKKEEERLRSQLRLENQQRRMRERRAYSSEEDD 525 Query: 387 TNE 395 E Sbjct: 526 GEE 528 >SB_46683| Best HMM Match : F5_F8_type_C (HMM E-Value=9.6e-12) Length = 495 Score = 28.3 bits (60), Expect = 3.4 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 10/60 (16%) Frame = +1 Query: 274 LLKAQLELYKSDFEAERESRQEMASE----------KETVLTDLRKTQRMNQELTQQLDE 423 LLK +++ D E ER+++QE++++ K+ L DL + R Q++T L E Sbjct: 70 LLKDRIQELVEDLEGERKTKQELSAQLIEERSLRELKQIELADLGEKLRDEQQITMSLKE 129 >SB_24434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1194 Score = 28.3 bits (60), Expect = 3.4 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = +1 Query: 259 KEDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 KE+ L+ L++ KS E + R EMASE+ + + R L + + + Sbjct: 797 KEEGTTLEGDLQVAKSVVLEEDKERDEMASERRRSIYEATSNPRCQGSLRESIQQ 851 >SB_22025| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.12) Length = 495 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/56 (21%), Positives = 28/56 (50%) Frame = +1 Query: 262 EDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVR 429 ++ E L+ +E S+ E + + + + +T+ + N+EL +LD+V+ Sbjct: 317 QENEELRGSIESLSSEIEIKSAENEHLRNALDTLHMEFEGRDLTNKELCDELDKVK 372 >SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) Length = 2059 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 47 HSAVLSNIGQVRGTLSIFEGIFKDCSNILDSK 142 H A++S +G R T +EG+ K+C+ + D K Sbjct: 1068 HIAIVSELGVCR-TEGFYEGLEKECAKLRDEK 1098 >SB_19362| Best HMM Match : M (HMM E-Value=0.0014) Length = 722 Score = 28.3 bits (60), Expect = 3.4 Identities = 25/105 (23%), Positives = 44/105 (41%), Gaps = 1/105 (0%) Frame = +2 Query: 29 QQLEKQHSAVLSNIGQVRGTLSIFEGIFKDCSNILDSKAKEAKNPGTPN-IEMLTSALVA 205 Q E + + + I Q++ ++ D +DS K+ N G +E + LVA Sbjct: 349 QNAEDEQARLQETIEQLQRKCETYKDKLNDKEKHIDSVKKD--NQGMDQAMEAMKKELVA 406 Query: 206 RGQELQMLKVEIDKLKGRKRTRSF*KHNSNCTRATSKRNESLVKR 340 E+Q LK E ++L+ R + T +K N S + + Sbjct: 407 TRSEMQRLKREHERLQRENAEREI---DRLTTEGVTKANNSKINQ 448 >SB_2332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1111 Score = 28.3 bits (60), Expect = 3.4 Identities = 17/60 (28%), Positives = 33/60 (55%) Frame = +1 Query: 265 DTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSD 444 ++ELL++Q EL S+F ES + +E+E Q +++E Q+ + +RR + + Sbjct: 25 ESELLESQPELLDSEFHGYDESLNPVPNEEEAA----EYEQHLHEENEQEEELLRRFSRE 80 >SB_37641| Best HMM Match : WXG100 (HMM E-Value=2) Length = 166 Score = 27.9 bits (59), Expect = 4.4 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 + L +Q + S+ + S Q+M + + V DL +T++ EL +LDE Sbjct: 58 KFLASQYDKVLSNLQGTNRSVQDMNANIQHVTQDLIETKKWLDELDSRLDE 108 >SB_36871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 343 ASEKETVLTDLRKTQRMNQELTQQLDEVRR 432 ASEKET ++ Q +EL ++LD+++R Sbjct: 26 ASEKETPEQKYQRLQHEMRELAEELDQIKR 55 >SB_34460| Best HMM Match : Borrelia_orfA (HMM E-Value=0.3) Length = 1102 Score = 27.9 bits (59), Expect = 4.4 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQ----RMNQELTQQLDEVRRLN 438 E LK E K + E +R + + TDL KTQ + ++ T + DE+ +L Sbjct: 669 ESLKTTAEALKKQLKDEAHARTVLQARIAADNTDLAKTQVDSKKKREKATIRADEIEKLV 728 Query: 439 SDVYQRAT 462 S V ++ + Sbjct: 729 SHVKEQVS 736 >SB_30230| Best HMM Match : CH (HMM E-Value=0.0035) Length = 2440 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 366 HGPQENSTNEPRADATAGRGTEAEL 440 H QENS+++ ATAG+GT L Sbjct: 266 HAWQENSSSDTNLAATAGKGTNISL 290 >SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) Length = 1292 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/49 (26%), Positives = 26/49 (53%) Frame = +1 Query: 298 YKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSD 444 +K A + ++++S+KE + + K +R QEL +Q + +N D Sbjct: 1234 HKEALTALNQKIKQLSSDKEEKMIQIGKLKRQVQELMEQQESGAEMNVD 1282 >SB_12816| Best HMM Match : PDT (HMM E-Value=0.7) Length = 366 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +1 Query: 307 DFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSDVYQR 456 D SRQE + E L+++ + +R N+EL Q +R L ++++ Sbjct: 280 DTNTSESSRQEASERNEERLSEIEELERENRELENQ-KPLRELIKAIFKK 328 >SB_12581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 756 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/44 (29%), Positives = 26/44 (59%) Frame = +1 Query: 295 LYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEV 426 L++ +A E +EM EKE + + + + +R +L +QL++V Sbjct: 641 LFRWRHQARVERMEEMKREKEKLESKITENKRQLDQLRKQLEQV 684 >SB_56887| Best HMM Match : TolA (HMM E-Value=0.66) Length = 404 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +1 Query: 280 KAQLELYKSDFEAER-ESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 K + YK DFE+E+ E +++ +E E V+ D + + + Q+ +E Sbjct: 260 KKDKDEYKDDFESEKDEGKEKEPAEAEEVIEDATEPKEVVQDTVDIKEE 308 >SB_57289| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.037) Length = 396 Score = 27.5 bits (58), Expect = 5.9 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 11/68 (16%) Frame = +1 Query: 277 LKAQLELYKSDFEAERESRQEMASEKETV----------LTDLR-KTQRMNQELTQQLDE 423 LK Q+E ++D +A +E QEM SE E +T+LR K + ++E+ Q+ + Sbjct: 214 LKKQIEPRENDIKAMKEQIQEMESELERFHKQNTSLELNITELRLKLKATDKEMHQERQK 273 Query: 424 VRRLNSDV 447 VR + + V Sbjct: 274 VRDVEAVV 281 >SB_52725| Best HMM Match : WD40 (HMM E-Value=2.1e-22) Length = 874 Score = 27.5 bits (58), Expect = 5.9 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 11/68 (16%) Frame = +1 Query: 277 LKAQLELYKSDFEAERESRQEMASEKETV----------LTDLR-KTQRMNQELTQQLDE 423 LK Q+E ++D +A +E QEM SE E +T+LR K + ++E+ Q+ + Sbjct: 660 LKKQIEPRENDIKAMKEQIQEMESELERFHKQNTSLELNITELRLKLKATDKEMHQERQK 719 Query: 424 VRRLNSDV 447 VR + + V Sbjct: 720 VRDVEAVV 727 >SB_45648| Best HMM Match : WD40 (HMM E-Value=2.4e-14) Length = 316 Score = 27.5 bits (58), Expect = 5.9 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +2 Query: 239 IDKLKGRKRTRSF*KHNSNCTRATSKRNESLVKRWPAKRRPCSRT-SGKLNE 391 I+ KG ++ S+ K N T S +S +K W + C RT G +NE Sbjct: 139 INVFKGHRKAVSYTKF-INSTEIVSASTDSQLKLWNINKPHCLRTFKGHINE 189 >SB_33387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 27.5 bits (58), Expect = 5.9 Identities = 19/81 (23%), Positives = 42/81 (51%), Gaps = 2/81 (2%) Frame = +2 Query: 17 AELKQQLEKQHSAVLSNIGQVRGTLSIFEGIFKDCSNILDSKAKEAKNPGTPNIEM--LT 190 +E +QLEK+ N + ++ EG+ K+ S+I + A + K+ + ++ + Sbjct: 735 SEKLEQLEKELLESRENEKKSSAAVTRLEGLEKNLSSIREELATKEKDMASTVQQLCEVE 794 Query: 191 SALVARGQELQMLKVEIDKLK 253 LV R E++ L+ E+ +++ Sbjct: 795 GKLVTRESEVKSLREELTRMQ 815 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 27.5 bits (58), Expect = 5.9 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -1 Query: 295 VRVVLSKAPCPLSPLQLIDLNFQHLQLLSAGHKRRGQHLNVGS 167 +R+VL K PCP L + + + SA +R GQ N+ + Sbjct: 43 IRIVLPKTPCPAEEKTLSVVRAKREREPSASPRRVGQVFNLAA 85 >SB_27687| Best HMM Match : zf-B_box (HMM E-Value=6.7e-10) Length = 237 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 295 LYKSDFEA-ERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRR 432 L+ SD A E+E E A + + LTD+ + + ++ Q LDE +R Sbjct: 41 LFTSDVIAREKEEILERAKKVTSKLTDIEQAMALVEKAQQHLDENKR 87 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 295 LYKSDFEA-ERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRR 432 L+ SD A E+E E A + + LTD+ + + ++ Q LDE +R Sbjct: 191 LFTSDVIAREKEEILERAKKVTSKLTDIEQAMALVEKAQQHLDENKR 237 >SB_3563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 27.5 bits (58), Expect = 5.9 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +1 Query: 301 KSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRR-LNSDVYQRATAN 468 KSD E ++ S + + +E + + QR N+E +LD+V L+S++ + T N Sbjct: 7 KSDVE-QKSSDMKQENIEEVQKKEQNEEQRENEEQNDELDKVEETLSSNIIEIETMN 62 >SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2851 Score = 27.5 bits (58), Expect = 5.9 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = +3 Query: 279 ESTTRTV-QERLRSGTRVSSRD--GQRKGDRAHGPQENSTNEPRADATAGRGTEAE 437 ES R+ Q R R G R RD G+R ++ QE S EP + +G + + Sbjct: 1115 ESKERSCDQRRTRDGDRYQGRDRDGERDQEQDRETQEESLREPEQEVGNIKGKDQD 1170 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 295 LYKSDFEA-ERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRR 432 L+ SD A E+E E A + + LTD+ + + ++ Q LDE +R Sbjct: 196 LFTSDVIAREKEEILERAKKVTSKLTDIEQAMALVEKAQQHLDENKR 242 >SB_38638| Best HMM Match : zf-B_box (HMM E-Value=6.8e-18) Length = 364 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 295 LYKSDFEA-ERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRR 432 L+ SD A E+E E A + + LTD+ + + +E Q L+E +R Sbjct: 165 LFTSDVIAREKEEILERAKKVASKLTDIEQAMALVEEAQQHLEENKR 211 >SB_37165| Best HMM Match : SH3_1 (HMM E-Value=0) Length = 1034 Score = 27.5 bits (58), Expect = 5.9 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 322 RESRQEMASEKETVLTDLRKTQR 390 R S+Q MA +++ VLT+L T+R Sbjct: 958 RSSQQHMAEQRQKVLTELLNTER 980 >SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 27.5 bits (58), Expect = 5.9 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 306 RLRSGTRVSSRDGQRKGDRAHGPQENSTNEPRADATAGR 422 R RS +R SSR G+R+ R+ E+ + + ATA + Sbjct: 718 RRRSRSRSSSRKGKRQRSRSWSYDEDYSKSSKGKATAAK 756 Score = 27.1 bits (57), Expect = 7.7 Identities = 17/59 (28%), Positives = 31/59 (52%) Frame = +2 Query: 242 DKLKGRKRTRSF*KHNSNCTRATSKRNESLVKRWPAKRRPCSRTSGKLNE*TKS*RNSW 418 D+ +GRKR+R + +S+ + + S+ R +RR SR+S + + +S SW Sbjct: 682 DRGRGRKRSRRRSRSSSHSSSSLSRSRSRSRSRGRGRRRSRSRSSSRKGKRQRS--RSW 738 >SB_592| Best HMM Match : DUF1279 (HMM E-Value=0.68) Length = 321 Score = 27.5 bits (58), Expect = 5.9 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 307 DFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQ 414 D + SRQE KE L+++ + +R N+EL Q Sbjct: 177 DPKTSESSRQEARERKEERLSEIDELERENRELENQ 212 >SB_53689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 + L +Q + S+ + S Q+M + + V DL +T+ EL +LDE Sbjct: 58 KFLASQYDKVLSNLQGTNRSVQDMNANIQHVTQDLIETKEWLDELDSRLDE 108 >SB_46204| Best HMM Match : bZIP_2 (HMM E-Value=1.8) Length = 277 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 307 DFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQ 414 D + SRQE E L+++ + +R NQEL Q Sbjct: 177 DPNSSESSRQEARERNEERLSEIGELERENQELENQ 212 >SB_41792| Best HMM Match : DUF495 (HMM E-Value=1.5) Length = 835 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 231 KLRSIS*RGERGHGAFESTTRTVQERLRSGTRVSSRDGQRKGDRAHGPQ 377 +LRS+ +GE A + T+T + + R+ + RD K + H PQ Sbjct: 354 ELRSLC-QGEAAPRATSAATKTREAKSRTKANCTGRDRAFKDETGHDPQ 401 >SB_23626| Best HMM Match : WXG100 (HMM E-Value=2) Length = 279 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 + L +Q + S+ + S Q+M + + V DL +T+ EL +LDE Sbjct: 58 KFLASQYDKVLSNLQGTNRSVQDMNANIQHVTQDLIETKEWLDELDSRLDE 108 >SB_22823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 + L +Q + S+ + S Q+M + + V DL +T+ EL +LDE Sbjct: 58 KFLASQYDKVLSNLQGTNRSVQDMNANIQHVTQDLIETKEWLDELDSRLDE 108 >SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1531 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = +1 Query: 280 KAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRL 435 K E + RE Q +E +L + QR QEL Q+LD+ L Sbjct: 1112 KQDSEETAQELRLSREQLQNTHAELMEARRELLRYQRKEQELVQELDDAHVL 1163 >SB_21353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 724 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +1 Query: 307 DFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSDVYQR 456 D SRQE + E L+++ + +R N+EL Q +R L ++++ Sbjct: 34 DTNTSESSRQEASERNEERLSEIDELERENRELENQ-KPLRELIKAIFKK 82 >SB_20871| Best HMM Match : Cauli_DNA-bind (HMM E-Value=0.99) Length = 252 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 + L +Q + S+ + S Q+M + + V DL +T+ EL +LDE Sbjct: 58 KFLASQYDKVLSNLQGTNRSVQDMNANIQHVTQDLIETKEWLDELDSRLDE 108 >SB_14736| Best HMM Match : Exonuc_VII_S (HMM E-Value=1.2) Length = 206 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +1 Query: 301 KSDFEAERESRQEMASEKETVLTDLRKTQ-RMNQELTQQLDEVRRLNSD 444 + DFE E + + +L D RKT + +EL++ E++R+ + Sbjct: 24 RQDFEKAFEEKDTTVQNLKKILDDSRKTNYELGRELSKNSTELQRVKDE 72 >SB_5091| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 + L +Q + S+ + S Q+M + + V DL +T+ EL +LDE Sbjct: 58 KFLASQYDKVLSNLQGTNRSVQDMNANIQHVTQDLIETKEWLDELDSRLDE 108 >SB_3093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/52 (25%), Positives = 24/52 (46%) Frame = +1 Query: 259 KEDTELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQ 414 +E+T + E + + RQE E L+++ + +R N+EL Q Sbjct: 159 QENTRAARGDRETIDDPYTSPPRGRQEARERNEERLSEIDELERENRELENQ 210 >SB_2658| Best HMM Match : CHASE3 (HMM E-Value=5.8) Length = 138 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = +1 Query: 307 DFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSDVYQR 456 D SRQE + E L+++ + +R N+EL Q +R L ++++ Sbjct: 34 DTNTSESSRQEASERNEERLSEIDELERENRELENQ-KPLRELIKAIFKK 82 >SB_58004| Best HMM Match : WXG100 (HMM E-Value=2) Length = 235 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 + L +Q + S+ + S Q+M + + V DL +T+ EL +LDE Sbjct: 58 KFLASQYDKVLSNLQGTNRSVQDMNANIQHVTQDLIETKEWLDELDSRLDE 108 >SB_57509| Best HMM Match : WXG100 (HMM E-Value=2) Length = 206 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 + L +Q + S+ + S Q+M + + V DL +T+ EL +LDE Sbjct: 58 KFLASQYDKVLSNLQGTNRSVQDMNANIQHVTQDLIETKEWLDELDSRLDE 108 >SB_46219| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 + L +Q + S+ + S Q+M + + V DL +T+ EL +LDE Sbjct: 58 KFLASQYDKVLSNLQGTNRSVQDMNANIQHVTQDLIETKEWLDELDSRLDE 108 >SB_37766| Best HMM Match : IncA (HMM E-Value=0.4) Length = 585 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 307 DFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQ 414 D + SRQE E L+++ + +R NQEL Q Sbjct: 164 DPNSSESSRQEARERNEERLSEIGELERENQELENQ 199 >SB_34971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 + L +Q + S+ + S Q+M + + V DL +T+ EL +LDE Sbjct: 58 KFLASQYDKVLSNLQGTNRSVQDMNANIQHVTQDLIETKEWLDELDSRLDE 108 >SB_34096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 348 RKGDRAHGPQENSTNEPRADATAGRG 425 R GD H + N+PR ATAG+G Sbjct: 221 RWGDSFHHVEARVLNQPRNSATAGQG 246 >SB_23474| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12) Length = 623 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 + L +Q + S+ + S Q+M + + V DL +T+ EL +LDE Sbjct: 58 KFLASQYDKVLSNLQGTNRSVQDMNANIQHVTQDLIETKEWLDELDSRLDE 108 >SB_19224| Best HMM Match : G5 (HMM E-Value=2.2) Length = 249 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +1 Query: 307 DFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDEVRRLNSDVYQRATAN 468 D + SRQE E L+++ + +R N+EL Q R+ + ++++ N Sbjct: 136 DPNSSESSRQEARERNEEKLSEIDELERENRELENQKPLRERIKA-IFKKGVGN 188 >SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1153 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 + L +Q + S+ + S Q+M + + V DL +T+ EL +LDE Sbjct: 58 KFLASQYDKVLSNLQGTNRSVQDMNANIQHVTQDLIETKEWLDELDSRLDE 108 >SB_15583| Best HMM Match : WXG100 (HMM E-Value=2) Length = 279 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = +1 Query: 271 ELLKAQLELYKSDFEAERESRQEMASEKETVLTDLRKTQRMNQELTQQLDE 423 + L +Q + S+ + S Q+M + + V DL +T+ EL +LDE Sbjct: 58 KFLASQYDKVLSNLQGTNRSVQDMNANIQHVTQDLIETKEWLDELDSRLDE 108 >SB_15139| Best HMM Match : Collagen (HMM E-Value=0.27) Length = 562 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = +3 Query: 312 RSGTRVSSRDGQRKGDRAHGPQENSTNEPRADATAGRGTEAELGRLPEG 458 R+ R ++R R +RA+ N N P A A GR+ G Sbjct: 196 RANNRANNRANNRANNRANNRANNRANNPSGGRVASGWRVASGGRVARG 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,419,999 Number of Sequences: 59808 Number of extensions: 207885 Number of successful extensions: 1374 Number of sequences better than 10.0: 96 Number of HSP's better than 10.0 without gapping: 1220 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1369 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 969807871 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -