BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021281 (586 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 112 2e-25 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 36 0.032 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 35 0.043 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 31 0.52 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 31 0.69 SB_3342| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 29 2.8 SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_56636| Best HMM Match : Toxin_4 (HMM E-Value=2.4) 29 3.7 SB_6230| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_5942| Best HMM Match : Sec7 (HMM E-Value=3.1e-09) 29 3.7 SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) 28 4.9 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_8252| Best HMM Match : rve (HMM E-Value=0.13) 28 4.9 SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) 28 6.4 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 28 6.4 SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 27 8.5 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 112 bits (270), Expect = 2e-25 Identities = 56/105 (53%), Positives = 66/105 (62%) Frame = +2 Query: 86 VGVFREE*DGAGCSQAPPVRVQGAHPSGPGQ*CSRFYVQELEAALLREQGGWSPNQSESW 265 + VF E + AG + P V P S + + + + G + +ESW Sbjct: 6 ITVFNENGESAGQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNKLAGHQTS-AESW 64 Query: 266 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 400 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK WR+WH Sbjct: 65 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRKWH 109 Score = 32.7 bits (71), Expect = 0.23 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 442 SVAATGVPALVQARGHIIEKIPGFP 516 ++AA+ +PAL+ ARGH IEKI P Sbjct: 124 ALAASALPALIMARGHRIEKIAEVP 148 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 35.5 bits (78), Expect = 0.032 Identities = 19/54 (35%), Positives = 22/54 (40%) Frame = +2 Query: 233 GGWSPNQSESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 394 GGW WG G+ + R GGG R G +G M GG P W R Sbjct: 14 GGWGQGPGGGWGRGQG-GGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 66 Score = 27.5 bits (58), Expect = 8.5 Identities = 18/54 (33%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +2 Query: 233 GGWSPNQSESWGT--GRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPW 388 GG WG G + R P GGG R G +G M GG P + W Sbjct: 54 GGMGRGPGGGWGRMQGGGMGRGP---GGGLGRGPGGGWGRMQEGGMGRGPGQGW 104 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 35.1 bits (77), Expect = 0.043 Identities = 19/54 (35%), Positives = 22/54 (40%) Frame = +2 Query: 233 GGWSPNQSESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 394 GGW WG G+ + R GGG R G +G M GG P W R Sbjct: 258 GGWGQGPGGGWGRGQGRG-MGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 310 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 31.5 bits (68), Expect = 0.52 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 359 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 276 HH RH R + +HHH H E+ R+H Sbjct: 325 HHQRHRHRHRHR-HRHHHHHHHEYNRRH 351 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 31.1 bits (67), Expect = 0.69 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 245 PNQSESWGTGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 364 P SE +G ++ R PR RGGG G G G RGGR Sbjct: 982 PTPSEPSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGRRGGR 1022 >SB_3342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/59 (30%), Positives = 32/59 (54%) Frame = -3 Query: 368 TYVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQTGLVTSLLAHAVGLPRVLGHR 192 +Y HH +RRH YHHH H + H + +I T L+ S+++ A+ + ++ +R Sbjct: 261 SYYHHHH-HRRHHLN--HYHHHYHLD---DHFIFIIIITTLIVSIISVAITVHILIPYR 313 >SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 368 TYVHHDTCYRRHPDRTYEYHHHGHA 294 TY H DT R+HPD H HA Sbjct: 123 TYTHQDTQMRKHPDTQIYVHAPRHA 147 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 29.1 bits (62), Expect = 2.8 Identities = 9/35 (25%), Positives = 14/35 (40%) Frame = -3 Query: 371 RTYVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQY 267 R + HH + H + +HHH H H + Sbjct: 209 RHHQHHQHHHHHHHQHNHHHHHHNHHHHHHHHYHH 243 >SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 344 YRRHPDRTYEYHHHGHAEFGRQHVQYPMI 258 Y +HP T+ YH H R H Q+P + Sbjct: 232 YHQHPQVTHRYHQHPQVTH-RYHQQHPQV 259 Score = 28.7 bits (61), Expect = 3.7 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 344 YRRHPDRTYEYHHHGHAEFGRQHVQYPMI 258 Y +HP T+ YHH H + ++ Q+P + Sbjct: 413 YHQHPQLTHRYHHQ-HPQVIHRYHQHPQV 440 >SB_56636| Best HMM Match : Toxin_4 (HMM E-Value=2.4) Length = 434 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 224 REQGGWSPNQSESWGTGRAVARIPRVRGGG 313 R + W P +S +W +A+ P VR GG Sbjct: 120 RPEAAWGPKRSGAWLGSQALVPQPAVRSGG 149 >SB_6230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 28.7 bits (61), Expect = 3.7 Identities = 18/65 (27%), Positives = 28/65 (43%) Frame = -3 Query: 323 TYEYHHHGHAEFGRQHVQYPMIQTGLVTSLLAHAVGLPRVLGHRNVNIIDQVRTDGRLEH 144 +Y+ H G + R+H Q + +T S GL +V + IID+ G + Sbjct: 26 SYKKEHRGLRKVSRKHAQRILDETAGHASYKKEHRGLRKVSREQAQRIIDETAGHGSYKK 85 Query: 143 EREGL 129 E GL Sbjct: 86 EYRGL 90 >SB_5942| Best HMM Match : Sec7 (HMM E-Value=3.1e-09) Length = 304 Score = 28.7 bits (61), Expect = 3.7 Identities = 10/45 (22%), Positives = 20/45 (44%) Frame = -3 Query: 365 YVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQTGLVTSLL 231 Y HH + H + +HHH H + + T ++T+++ Sbjct: 158 YYHHHLLHHHHHHWHHHHHHHRHHHHSFTTIATTTVITTIITTVI 202 >SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) Length = 193 Score = 28.3 bits (60), Expect = 4.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 359 HHDTCYRRHPDRTYEYHHH 303 HH YR H + Y +HHH Sbjct: 96 HHHQHYRHHRHQHYRHHHH 114 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 139 GRGLAAPCTVSLFSEYTDTKGRATDRLI 56 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_8252| Best HMM Match : rve (HMM E-Value=0.13) Length = 264 Score = 28.3 bits (60), Expect = 4.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 365 YVHHDTCYRRHPDRTYEYHHHGH 297 Y HH +RR R + +HHH H Sbjct: 233 YHHHHHHHRRRRRRRHHHHHHHH 255 >SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) Length = 839 Score = 27.9 bits (59), Expect = 6.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 359 HHDTCYRRHPDRTYEYHHH 303 HH + RH R + YHHH Sbjct: 570 HHHLHHHRHHHRHHHYHHH 588 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 27.9 bits (59), Expect = 6.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 359 HHDTCYRRHPDRTYEYHHHGH 297 HH + RH DR + + HH H Sbjct: 340 HHRNKHYRHHDRNHHHRHHHH 360 >SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -3 Query: 368 TYVHHDTCYRRHPDRTYEYHHHGHA 294 TY H DT +HPD H HA Sbjct: 323 TYTHQDTQMHKHPDTQMYVHAPRHA 347 >SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 27.5 bits (58), Expect = 8.5 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -3 Query: 347 CYRRHPDRTYEYHHHGHAEFGRQHVQY 267 CY + + + YHHH H H Q+ Sbjct: 246 CYHKLKNPRHRYHHHHHHHHQHNHHQH 272 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 365 YVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQ 270 Y HH + +H + +HHH H H Q Sbjct: 257 YHHHHHHHHQHNHHQHHHHHHHHHHNHHHHHQ 288 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 27.5 bits (58), Expect = 8.5 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -3 Query: 371 RTYVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYP 264 R Y HH C H Y Y HH H + R H YP Sbjct: 15 RCYRHHHYCCYCHHRYCY-YRHH-HYCWYRHHYHYP 48 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,764,867 Number of Sequences: 59808 Number of extensions: 364938 Number of successful extensions: 1203 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1147 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -