BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021281 (586 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 104 4e-23 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 104 4e-23 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 1.7 At2g44980.2 68415.m05601 transcription regulatory protein SNF2, ... 29 2.3 At2g44980.1 68415.m05600 transcription regulatory protein SNF2, ... 29 2.3 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 28 4.0 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 4.0 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 5.3 At3g12430.1 68416.m01548 expressed protein ; expression supporte... 28 5.3 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 27 7.0 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 27 7.0 At5g01010.1 68418.m00001 expressed protein 27 7.0 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 27 7.0 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 27 7.0 At1g76010.1 68414.m08825 expressed protein 27 7.0 At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to S... 27 9.2 At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to S... 27 9.2 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 104 bits (250), Expect = 4e-23 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +2 Query: 254 SESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 400 +ESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 70 AESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 118 Score = 71.3 bits (167), Expect = 4e-13 Identities = 36/65 (55%), Positives = 43/65 (66%), Gaps = 2/65 (3%) Frame = +3 Query: 66 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 239 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+A Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKA 64 Query: 240 GHQTS 254 GHQTS Sbjct: 65 GHQTS 69 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +1 Query: 442 SVAATGVPALVQARGHIIEKIPGFP 516 ++AAT VPALV ARGH IE +P P Sbjct: 133 AIAATAVPALVMARGHKIENVPEMP 157 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 104 bits (250), Expect = 4e-23 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +2 Query: 254 SESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 400 +ESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 69 AESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWH 117 Score = 73.3 bits (172), Expect = 1e-13 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 2/68 (2%) Frame = +3 Query: 57 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 230 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 231 KEAGHQTS 254 K+AGHQTS Sbjct: 61 KKAGHQTS 68 Score = 37.9 bits (84), Expect = 0.005 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +1 Query: 442 SVAATGVPALVQARGHIIEKIPGFP 516 ++AAT VPALV ARGH IE +P P Sbjct: 132 AIAATAVPALVMARGHKIENVPEMP 156 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +3 Query: 81 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 227 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At2g44980.2 68415.m05601 transcription regulatory protein SNF2, putative similar to SNF2P [Oryza sativa (japonica cultivar-group)] GI:23193483; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; CG donor site annotated in one isoform based on protein alignments. Length = 870 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 548 VDLLEFVGYNQGKPGIFSIMCPLA*T 471 + L ++ + QG PG F ++CPL+ T Sbjct: 88 ISFLSYLKFRQGLPGPFLVLCPLSVT 113 >At2g44980.1 68415.m05600 transcription regulatory protein SNF2, putative similar to SNF2P [Oryza sativa (japonica cultivar-group)] GI:23193483; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; CG donor site annotated in one isoform based on protein alignments. Length = 851 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 548 VDLLEFVGYNQGKPGIFSIMCPLA*T 471 + L ++ + QG PG F ++CPL+ T Sbjct: 88 ISFLSYLKFRQGLPGPFLVLCPLSVT 113 >At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; glycine-rich protein 18 (GRP18) PMID:11431566; Length = 228 Score = 28.3 bits (60), Expect = 4.0 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Frame = +2 Query: 206 LEAALLREQGGWSPNQSESWGTGRAVARIPRVRGGGTHRSGQ---GAFGNMCRGGRMFAP 376 + AL+R + G P +E + + + ++P G G G+ G FGN GG F Sbjct: 76 MAVALIRRRMGAKPT-AEGTSSAQPLLKLPVYGGYGGFWGGKKFSGTFGNKPGGGNPFGD 134 Query: 377 TKPW 388 W Sbjct: 135 ISKW 138 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 132 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 227 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 7.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 132 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 227 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 5.3 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 359 HHDTCYRRHPDRTYEYHHHGHAEF 288 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At3g12430.1 68416.m01548 expressed protein ; expression supported by MPSS Length = 238 Score = 27.9 bits (59), Expect = 5.3 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -2 Query: 135 GAWLHPAPSHSSLNTPTLKVGLPID--SFRYFSEAIPLKY 22 G W+H SH+ ++ L VG+ + Y+S + P++Y Sbjct: 38 GQWIHDVLSHNRFSSHPLVVGVGVQWTPSSYYSASSPVRY 77 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 27.5 bits (58), Expect = 7.0 Identities = 12/42 (28%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -3 Query: 371 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQTG 249 R++ H + +H D + E+HHH H R+H ++ G Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEHG 776 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 27.5 bits (58), Expect = 7.0 Identities = 12/42 (28%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -3 Query: 371 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQTG 249 R++ H + +H D + E+HHH H R+H ++ G Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEHG 776 >At5g01010.1 68418.m00001 expressed protein Length = 409 Score = 27.5 bits (58), Expect = 7.0 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = -3 Query: 254 TGLVTSLLAHAVGLPRVLGHRNVNIIDQVR-TDGRLEHEREGLG 126 TG+ +L+ + VG+P+VL ++ I Q+ DG +E +RE G Sbjct: 204 TGVYKTLVKYLVGVPQVL----LDFIRQINDDDGPMEEQRERYG 243 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 27.5 bits (58), Expect = 7.0 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +2 Query: 230 QGGWSPNQSESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 361 QGG Q G GR R +GGG + G G+ G+ CR G Sbjct: 79 QGGGGRYQG---GGGRYQGGGGRYQGGGGRQGGGGSGGSYCRHG 119 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.5 bits (58), Expect = 7.0 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -3 Query: 359 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 276 HHD + H D +++ HH H H Sbjct: 311 HHDHDHDHHHDHNHDHDHHHHDGHDHHH 338 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 27.5 bits (58), Expect = 7.0 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = +2 Query: 230 QGGWSPNQSESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRG 358 +GG+ Q G GR R R RGGG R G G F N G Sbjct: 305 RGGYDGPQGRGRGRGRG--RGGRGRGGG--RGGDGGFNNRSDG 343 >At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1050 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +2 Query: 236 GWSPNQSESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAP 376 G P Q + +G + R RGG H+ G+G +G GG P Sbjct: 65 GQPPQQQQQYGGPQEYQG--RGRGGPPHQGGRGGYGGGRGGGPSSGP 109 >At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1048 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +2 Query: 236 GWSPNQSESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAP 376 G P Q + +G + R RGG H+ G+G +G GG P Sbjct: 65 GQPPQQQQQYGGPQEYQG--RGRGGPPHQGGRGGYGGGRGGGPSSGP 109 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,358,335 Number of Sequences: 28952 Number of extensions: 254773 Number of successful extensions: 902 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 825 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 891 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -