BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021280 (701 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 25 1.7 Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 24 4.0 Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. 24 5.3 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 7.0 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 7.0 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 7.0 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 7.0 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 7.0 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 7.0 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 7.0 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 7.0 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 7.0 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 7.0 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 7.0 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 7.0 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 7.0 CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 23 7.0 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 7.0 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 25.4 bits (53), Expect = 1.7 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +2 Query: 554 EKNEHADEWGG---YFVIKGHERLARMLLVTRRNYP 652 E N D GG Y ++ GHE L +++ T R YP Sbjct: 343 ELNRSIDANGGELTYDMVMGHEYLGQVVNETLRKYP 378 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 24.2 bits (50), Expect = 4.0 Identities = 21/80 (26%), Positives = 33/80 (41%), Gaps = 3/80 (3%) Frame = -1 Query: 371 DLTPTVSMGTLGLANAASSI---VTLTFSPLGNSNSDGNRSA*QTSSHRPAYN*MNLCEA 201 +LT + S+ +GL ++ T S GN+ S +A +++ P N +A Sbjct: 142 ELTFSDSVQPVGLPKQDETVKDGTMTTVSGWGNTQSAAESNAVLRAANVPTVNQKECNKA 201 Query: 200 LQDFEGTDLLFLVVFYNLGG 141 DF G L Y GG Sbjct: 202 YSDFGGVTDRMLCAGYQQGG 221 >Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 23.8 bits (49), Expect = 5.3 Identities = 16/54 (29%), Positives = 22/54 (40%) Frame = -1 Query: 302 TFSPLGNSNSDGNRSA*QTSSHRPAYN*MNLCEALQDFEGTDLLFLVVFYNLGG 141 T S GN+ S +A +++ P N +A DF G L Y GG Sbjct: 168 TVSGWGNTQSAAESNAVLRAANVPTVNQKECNKAYSDFGGVTDRMLCAGYQQGG 221 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 608 RGP-LLQNIHPIHQHVHFSQQ 549 RGP LLQ++H I + HF ++ Sbjct: 43 RGPVLLQDVHLIDELAHFDRE 63 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 608 RGP-LLQNIHPIHQHVHFSQQ 549 RGP LLQ++H I + HF ++ Sbjct: 43 RGPVLLQDVHLIDELAHFDRE 63 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 608 RGP-LLQNIHPIHQHVHFSQQ 549 RGP LLQ++H I + HF ++ Sbjct: 43 RGPVLLQDVHLIDELAHFDRE 63 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 608 RGP-LLQNIHPIHQHVHFSQQ 549 RGP LLQ++H I + HF ++ Sbjct: 43 RGPVLLQDVHLIDELAHFDRE 63 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 608 RGP-LLQNIHPIHQHVHFSQQ 549 RGP LLQ++H I + HF ++ Sbjct: 43 RGPVLLQDVHLIDELAHFDRE 63 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 608 RGP-LLQNIHPIHQHVHFSQQ 549 RGP LLQ++H I + HF ++ Sbjct: 43 RGPVLLQDVHLIDELAHFDRE 63 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 608 RGP-LLQNIHPIHQHVHFSQQ 549 RGP LLQ++H I + HF ++ Sbjct: 43 RGPVLLQDVHLIDELAHFDRE 63 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 608 RGP-LLQNIHPIHQHVHFSQQ 549 RGP LLQ++H I + HF ++ Sbjct: 43 RGPVLLQDVHLIDELAHFDRE 63 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 608 RGP-LLQNIHPIHQHVHFSQQ 549 RGP LLQ++H I + HF ++ Sbjct: 43 RGPVLLQDVHLIDELAHFDRE 63 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 608 RGP-LLQNIHPIHQHVHFSQQ 549 RGP LLQ++H I + HF ++ Sbjct: 43 RGPVLLQDVHLIDELAHFDRE 63 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 608 RGP-LLQNIHPIHQHVHFSQQ 549 RGP LLQ++H I + HF ++ Sbjct: 43 RGPVLLQDVHLIDELAHFDRE 63 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 608 RGP-LLQNIHPIHQHVHFSQQ 549 RGP LLQ++H I + HF ++ Sbjct: 43 RGPVLLQDVHLIDELAHFDRE 63 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 608 RGP-LLQNIHPIHQHVHFSQQ 549 RGP LLQ++H I + HF ++ Sbjct: 43 RGPVLLQDVHLIDELAHFDRE 63 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 341 LGLANAASSIVTLTFSPLGNSNSDGNR 261 LG+ A S++TLT P +S SD R Sbjct: 10 LGIVLAFLSVLTLTLLPPVSSQSDPTR 36 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 608 RGP-LLQNIHPIHQHVHFSQQ 549 RGP LLQ++H I + HF ++ Sbjct: 27 RGPVLLQDVHLIDELAHFDRE 47 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 762,024 Number of Sequences: 2352 Number of extensions: 16232 Number of successful extensions: 40 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -