BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021280 (701 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 26 0.40 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 2.1 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 25.8 bits (54), Expect = 0.40 Identities = 19/71 (26%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Frame = -1 Query: 440 TLIFNSPLYVAALCRHSVGRTT*DLTPTVSMGTLGLANAASSI-VTLTFSPLGNSNSDGN 264 T+ F PL+V + + R T ++ +GT + A+ + +TL G +N+D Sbjct: 212 TISFYLPLFVMVFTYYKIYRAAVIQTKSLKLGTKQVLMASGELELTLRIHRGGGTNTDA- 270 Query: 263 RSA*QTSSHRP 231 R +T+S P Sbjct: 271 RHLFRTASSTP 281 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +1 Query: 610 ASSPYVVGYTKELPCGHQAVRMED 681 A SPY K PC H + ++D Sbjct: 52 ACSPYFRELLKSTPCKHPVIVLQD 75 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,661 Number of Sequences: 438 Number of extensions: 4248 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -