BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021278 (732 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 87 1e-17 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 67 1e-11 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 59 4e-09 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 57 1e-08 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 50 3e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 49 4e-06 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 47 1e-05 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 46 3e-05 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 44 1e-04 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 41 0.001 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 40 0.002 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 39 0.005 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 39 0.005 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 37 0.015 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 37 0.019 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 36 0.045 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 33 0.24 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 33 0.24 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 30 1.7 SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 29 3.9 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 9.0 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 28 9.0 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 87.0 bits (206), Expect = 1e-17 Identities = 38/60 (63%), Positives = 48/60 (80%) Frame = +2 Query: 545 YILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPK 724 +ILP IVHIN+QP ++ GDGPI LVL PTRELAQQ+Q+VA G +R+TC++GGAPK Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPK 172 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = +1 Query: 307 RSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 474 R +EV+ YR ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/72 (52%), Positives = 48/72 (66%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 694 ++TGSGKT A++ PA+VHI +QP ++ GDGPI L+ APTREL QQI A FG + Sbjct: 561 AKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFGKAYNIH 620 Query: 695 NTCVFGGAPKRE 730 VFGG K E Sbjct: 621 VVAVFGGGNKYE 632 Score = 74.9 bits (176), Expect = 6e-14 Identities = 31/84 (36%), Positives = 50/84 (59%) Frame = +1 Query: 259 QPFNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKT 438 +PFNKNFY+ HP + K+S E+++ R K + VSG P F F + + ++ Sbjct: 475 KPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDEQMMASIRK 534 Query: 439 MGYKEPTPIQAQGWPIAMSGKNLV 510 + Y +PT IQ Q PIA+SG++++ Sbjct: 535 LEYTQPTQIQCQALPIALSGRDII 558 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 67.3 bits (157), Expect = 1e-11 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 4/74 (5%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINNQPPIRRGD----GPIALVLAPTRELAQQIQQVAADFGHT 682 ++TGSGKT A+ +P +V I P I R + GP AL+LAPTRELAQQI++ FG Sbjct: 145 AETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKFGRP 204 Query: 683 SYVRNTCVFGGAPK 724 +R V GGA + Sbjct: 205 LGIRTVSVIGGADR 218 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/60 (33%), Positives = 36/60 (60%) Frame = +1 Query: 331 YRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 510 +R ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + ++++ Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDII 142 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 61.7 bits (143), Expect = 6e-10 Identities = 30/86 (34%), Positives = 49/86 (56%), Gaps = 1/86 (1%) Frame = +1 Query: 259 QPFNKNFYDPHPTVLKRSPYEVEEYRNKHE-VTVSGVEVHNPIQYFEEANFPDYVQQGVK 435 QPF K+FY P + K +P E +E+R E + V G P++ + + + +K Sbjct: 62 QPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILDVLK 121 Query: 436 TMGYKEPTPIQAQGWPIAMSGKNLVA 513 Y++PTPIQAQ P+ MSG++++A Sbjct: 122 KNSYEKPTPIQAQAIPVIMSGRDMIA 147 Score = 41.5 bits (93), Expect = 7e-04 Identities = 23/61 (37%), Positives = 31/61 (50%) Frame = +2 Query: 533 KTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFG 712 K +Y P + P I G IA+V+ PTRELA QI + F + +R CV+G Sbjct: 121 KKNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYG 180 Query: 713 G 715 G Sbjct: 181 G 181 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 58.8 bits (136), Expect = 4e-09 Identities = 25/77 (32%), Positives = 45/77 (58%) Frame = +1 Query: 280 YDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 459 Y HPT+ + +V++ R+K E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 460 PIQAQGWPIAMSGKNLV 510 PIQ Q P+ +SG++++ Sbjct: 221 PIQMQVLPVLLSGRDVM 237 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI 652 ++TGSGKTLAY LP + + + P GD P+AL+L PTREL QQ+ Sbjct: 116 AETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQV 161 Score = 50.4 bits (115), Expect = 1e-06 Identities = 24/82 (29%), Positives = 43/82 (52%) Frame = +1 Query: 265 FNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 444 F ++YD + V + S V+E R K+ + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 445 YKEPTPIQAQGWPIAMSGKNLV 510 ++ PTPIQ Q MSG++++ Sbjct: 92 FQVPTPIQMQSLSCVMSGRDII 113 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 52.8 bits (121), Expect = 3e-07 Identities = 28/67 (41%), Positives = 39/67 (58%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 694 +QTGSGKT AY+LP + + Q P+AL +APTRELA+QI A F + ++ Sbjct: 523 AQTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDHTPIK 582 Query: 695 NTCVFGG 715 +GG Sbjct: 583 VCVCYGG 589 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = +1 Query: 355 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 513 VSG I F E F + + + GY+ PTP+Q PI M+G++L+A Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMA 521 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 51.2 bits (117), Expect = 8e-07 Identities = 30/74 (40%), Positives = 42/74 (56%), Gaps = 1/74 (1%) Frame = +2 Query: 512 RSQTGSGKTLAYILPAIVHINNQPPIRRG-DGPIALVLAPTRELAQQIQQVAADFGHTSY 688 ++Q+G+GKT + + + I+ + G D ALVLAPTRELAQQIQ+V G + Sbjct: 128 QAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMH 187 Query: 689 VRNTCVFGGAPKRE 730 V+ GG RE Sbjct: 188 VKCHACIGGTNVRE 201 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 51.2 bits (117), Expect = 8e-07 Identities = 28/71 (39%), Positives = 38/71 (53%), Gaps = 4/71 (5%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINN----QPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHT 682 +QTGSGKT A++LP + + N P A+ +APTRELA QI A F H Sbjct: 755 AQTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEARKFAHG 814 Query: 683 SYVRNTCVFGG 715 + +R +GG Sbjct: 815 TMLRPVVCYGG 825 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/63 (38%), Positives = 37/63 (58%) Frame = +1 Query: 325 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 504 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++ Sbjct: 692 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRD 750 Query: 505 LVA 513 ++A Sbjct: 751 VMA 753 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 49.6 bits (113), Expect = 3e-06 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 1/71 (1%) Frame = +2 Query: 512 RSQTGSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSY 688 +++TG+GKTL++ LP + + + + +RG P LV+APTRELA+Q+ + S Sbjct: 116 QARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQVGNEFENL--KSN 173 Query: 689 VRNTCVFGGAP 721 + C++GG P Sbjct: 174 LEVYCIYGGMP 184 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%) Frame = +1 Query: 319 EVEEYRNKHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 486 ++ +R++ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 487 AMSG 498 G Sbjct: 197 MAHG 200 Score = 27.9 bits (59), Expect = 9.0 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +2 Query: 545 YILPAIVHINNQPPIRRG---DGPIALVLAPTRELAQQI 652 Y P + + P + G G A+V++PTRELAQQI Sbjct: 183 YTTPTPIQMQATPLMAHGPKKSGFRAVVVSPTRELAQQI 221 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 47.2 bits (107), Expect = 1e-05 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 5/76 (6%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINNQPPIRRG-----DGPIALVLAPTRELAQQIQQVAADFGH 679 +QTGSGKTLAY+ P +VH + R G P A ++ P RELA QI + A H Sbjct: 422 AQTGSGKTLAYLAP-LVHRLREDEERHGILARLKRPRACIVVPARELATQILKTAKSLCH 480 Query: 680 TSYVRNTCVFGGAPKR 727 + R+ + GG ++ Sbjct: 481 HARFRSVGLIGGRKQK 496 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 46.0 bits (104), Expect = 3e-05 Identities = 27/67 (40%), Positives = 39/67 (58%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 694 ++TGSGKTLA+++P I + Q DG ALV++PTRELA Q +V G+ + Sbjct: 94 AKTGSGKTLAFLIPIIETLWRQKWTSM-DGLGALVISPTRELAYQTFEVLVKIGNKHDLS 152 Query: 695 NTCVFGG 715 + GG Sbjct: 153 AGLIIGG 159 Score = 31.9 bits (69), Expect = 0.55 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +1 Query: 382 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 510 ++ F + G+ G+ PT IQ QG P+A+SG++++ Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVL 91 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/67 (34%), Positives = 39/67 (58%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 694 ++TGSGKT A+++P + G AL+L+PTRELA Q Q+ + G + ++ Sbjct: 325 ARTGSGKTAAFLIPMFEKLQTHTA---KVGIRALILSPTRELALQTQKFIKELGRFTGLK 381 Query: 695 NTCVFGG 715 ++ + GG Sbjct: 382 SSVILGG 388 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/63 (38%), Positives = 37/63 (58%) Frame = +1 Query: 325 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 504 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++ Sbjct: 115 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRD 173 Query: 505 LVA 513 ++A Sbjct: 174 VMA 176 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 43.2 bits (97), Expect = 2e-04 Identities = 27/68 (39%), Positives = 39/68 (57%) Frame = +2 Query: 512 RSQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 691 ++Q+G+GKT + + + I+ Q +R P ALVL+PTRELA QIQ+V G V Sbjct: 40 QAQSGTGKTATFSISVLQAIDTQ--LRE---PQALVLSPTRELANQIQKVVLALGDYMSV 94 Query: 692 RNTCVFGG 715 + GG Sbjct: 95 QCHACIGG 102 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/52 (38%), Positives = 35/52 (67%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAAD 670 ++TGSGKTLA+++P +V + + + +G ++++PTREL+ Q VA D Sbjct: 616 AKTGSGKTLAFLVP-VVELLYKLQFKTRNGTGVIIISPTRELSLQTYGVARD 666 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 41.1 bits (92), Expect = 0.001 Identities = 31/88 (35%), Positives = 46/88 (52%), Gaps = 16/88 (18%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHIN-------NQPPI-------RRGDGPIALVLAPTRELAQQI 652 ++TGSGKTLA+ +P I HI Q P +G +AL++APTRELA Q+ Sbjct: 175 AETGSGKTLAFGIPIIQHIEAYKKRKAEQSPSDKESDLESQGYPLLALIMAPTRELALQV 234 Query: 653 QQVAADFGHTSYVRNTCVFGG--APKRE 730 + + V+ + GG APK++ Sbjct: 235 KDHLVKAAKYTSVKVAAIVGGMAAPKQQ 262 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/67 (37%), Positives = 35/67 (52%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 694 ++TGSGKT A+ LP + + + P G A+VL PTRELA QI G ++ Sbjct: 51 AKTGSGKTAAFALPILQKLCDDPY-----GIFAVVLTPTRELAFQIADQFKVLGRPIGLK 105 Query: 695 NTCVFGG 715 + GG Sbjct: 106 EAVIVGG 112 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/67 (37%), Positives = 35/67 (52%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVR 694 ++TGSGKT A+ LP + + + P AL+L PTRELA QI + G V+ Sbjct: 8 AETGSGKTGAFALPILQALLDNP-----QRLFALILTPTRELAFQISEQCEALGSGIGVK 62 Query: 695 NTCVFGG 715 + GG Sbjct: 63 CAVIVGG 69 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/55 (38%), Positives = 31/55 (56%) Frame = +2 Query: 512 RSQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 676 R++ G+GKT AY++P + + + ALVL PTRELA Q Q+ + G Sbjct: 90 RAKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELG 139 Score = 32.3 bits (70), Expect = 0.42 Identities = 12/41 (29%), Positives = 26/41 (63%) Frame = +1 Query: 391 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 513 FE+ + G+ G+ +P+PIQ + P+A++G++++A Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILA 89 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/55 (38%), Positives = 31/55 (56%) Frame = +2 Query: 512 RSQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 676 R++ G+GKT AY++P + + + ALVL PTRELA Q Q+ + G Sbjct: 90 RAKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELG 139 Score = 32.3 bits (70), Expect = 0.42 Identities = 12/41 (29%), Positives = 26/41 (63%) Frame = +1 Query: 391 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 513 FE+ + G+ G+ +P+PIQ + P+A++G++++A Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILA 89 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 37.1 bits (82), Expect = 0.015 Identities = 21/62 (33%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = +2 Query: 512 RSQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSY 688 +SQ+G+GKT A++L + ++ P P + L+PT ELA+Q +VA G H + Sbjct: 148 QSQSGTGKTAAFVLTMLSRVDATKPY-----PQVICLSPTYELARQTGKVAEAMGKHCPH 202 Query: 689 VR 694 ++ Sbjct: 203 IK 204 Score = 31.1 bits (67), Expect = 0.96 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = +1 Query: 340 KHEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMS 495 KHEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 85 KHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLA 139 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 36.7 bits (81), Expect = 0.019 Identities = 25/61 (40%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = +2 Query: 512 RSQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSY 688 +S+TG+GK+L ++LP++ Q P RG G I ++ PTRELA Q + +V+ G S Sbjct: 203 KSETGTGKSLVFLLPSV-----QDP-GRGYGTI--IVVPTRELASQMLYEVSRLLGDKSI 254 Query: 689 V 691 V Sbjct: 255 V 255 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 35.5 bits (78), Expect = 0.045 Identities = 19/37 (51%), Positives = 22/37 (59%) Frame = +2 Query: 605 PIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGG 715 P ALVL+PTRELA QIQ+V G V+ GG Sbjct: 4 PQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGG 40 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +1 Query: 382 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 513 I FE+ + + + V GYK+PTP+Q PI ++L+A Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMA 917 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINNQPP 586 +QTGSGKT A+++P + I + P Sbjct: 919 AQTGSGKTAAFLIPILSRIYMEGP 942 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +2 Query: 521 TGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 649 TG+GKT A++LP + + +P + LV+ PTRELA Q Sbjct: 56 TGTGKTAAFMLPILERLLYRP--TQSPAIRVLVITPTRELAIQ 96 Score = 32.7 bits (71), Expect = 0.32 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 424 QGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 513 + V +G+ PTPIQA P+A+ GK++ A Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDVCA 52 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 33.1 bits (72), Expect = 0.24 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 4/73 (5%) Frame = +2 Query: 524 GSGKTLAYILPAIVHINNQPPIRR---GDGPIALVLAPTRELAQQIQQVAAD-FGHTSYV 691 GSGK LAY+LP I I + +GP+ L+L + ++ V D + Sbjct: 234 GSGKRLAYLLPIIHQITESSVYQELPLANGPLVLILCTNWQNTARVYGVCEDLIRNRRRT 293 Query: 692 RNTCVFGGAPKRE 730 R +FGG + + Sbjct: 294 RVQMIFGGGAEED 306 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 367 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 480 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +1 Query: 313 PYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 444 P+E + + KH++ V+ VE + +Q +E F + ++Q VK G Sbjct: 252 PFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQ-VKDTG 294 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 197 HQSLQILQIYCHRCQTETNYRRICCLLQIWNHRFHGY 87 H L YC RC T CCLLQ++++ ++G+ Sbjct: 484 HLQQPSLAAYC-RCITILTTAIACCLLQVYHNTYNGH 519 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 325 EEYRNK-HEVTVSGVEVHNPIQYFEEANFPDY 417 EE NK H++ + + +HNP YFE+ + DY Sbjct: 234 EEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 262 VGVNRIPIWASHVLPSREF 206 VGV I WAS++LPSR+F Sbjct: 10 VGVRDIEQWASNLLPSRQF 28 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 9.0 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -2 Query: 221 ALQRILFSHQSLQILQIYCHRCQTETNYRRICCLLQIWN-HRFHGYYSS 78 AL+RI + ++ C +YRR CC L +W H + Y+SS Sbjct: 197 ALERIATPVTTSKLRCSTTQECCVRVDYRRKCC-LHVWRVHTTNTYWSS 244 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 27.9 bits (59), Expect = 9.0 Identities = 15/55 (27%), Positives = 31/55 (56%) Frame = +2 Query: 512 RSQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 676 ++++G+GKT + + A+ ++ I + ++L PTRE+A Q++ V G Sbjct: 56 QAKSGTGKTCVFSVIALENV-----ITESNCIQIIILTPTREIAVQVKDVICAIG 105 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,362,388 Number of Sequences: 59808 Number of extensions: 480617 Number of successful extensions: 1241 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 1146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1225 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -