BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021272 (685 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19A8.01c |sec73|sec7c, SPAC23H3.01|guanyl-nucleotide exchang... 28 1.4 SPBC3B9.07c |rpa43|rpa21|DNA-directed RNA polymerase I complex s... 26 4.4 SPCC736.11 |ago1|csp9|argonaute|Schizosaccharomyces pombe|chr 3|... 25 7.7 SPAC688.13 |scn1||TatD DNase family Scn1|Schizosaccharomyces pom... 25 7.7 >SPAC19A8.01c |sec73|sec7c, SPAC23H3.01|guanyl-nucleotide exchange factor Sec73 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1082 Score = 27.9 bits (59), Expect = 1.4 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 247 PVFSSKSWCPDTNSTSGS 300 P +S KSW PD NST+ S Sbjct: 162 PKWSRKSWNPDVNSTTSS 179 >SPBC3B9.07c |rpa43|rpa21|DNA-directed RNA polymerase I complex subunit Rpa43|Schizosaccharomyces pombe|chr 2|||Manual Length = 173 Score = 26.2 bits (55), Expect = 4.4 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = -2 Query: 663 FAVNTHQCLSDSRAVFFWRNIDVILIQAPFGSCFNSKI 550 F + + + DS F W +DV++ G C KI Sbjct: 56 FLEKSAKVMYDSPFSFIWVRVDVLVFSPKKGDCLEGKI 93 >SPCC736.11 |ago1|csp9|argonaute|Schizosaccharomyces pombe|chr 3|||Manual Length = 834 Score = 25.4 bits (53), Expect = 7.7 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 514 GTSGTPLDLLANYFTVETTPKWGLYQYHV 600 G G + L AN+F + + P + QYHV Sbjct: 16 GGLGKQITLKANFFQIISLPNETINQYHV 44 >SPAC688.13 |scn1||TatD DNase family Scn1|Schizosaccharomyces pombe|chr 1|||Manual Length = 335 Score = 25.4 bits (53), Expect = 7.7 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = -3 Query: 683 KRYPPSVLL*TRISAFRTPELSSSGEIST*Y*YRPHLGVVSTVK*LASRSRGVPE 519 K YPP + L + + S+ ++ T + Y +G+ S K +GVP+ Sbjct: 229 KHYPPKICLHSYSGSIEQISQFSAHKVPTEFYYSFSIGINSRYKNFIQTLKGVPD 283 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,518,949 Number of Sequences: 5004 Number of extensions: 48885 Number of successful extensions: 129 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -