BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021271 (689 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 24 5.2 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 24 5.2 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 5.2 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 23 6.9 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 9.1 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 23.8 bits (49), Expect = 5.2 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 410 LFEISQFARVQINFLLYQY 354 L +S +AR ++N +LYQY Sbjct: 108 LMSVSSYARDRLNPVLYQY 126 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 23.8 bits (49), Expect = 5.2 Identities = 7/23 (30%), Positives = 17/23 (73%) Frame = +2 Query: 452 PEDVYKEYTKDSYGWSVVNRSLR 520 PE++ + + + Y WS+V++++R Sbjct: 950 PENIIEVMSANRYNWSMVHQAVR 972 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.8 bits (49), Expect = 5.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 115 SLLFHYKQLNIIYDGFGVLDTYKRNS 38 ++L H+ +LN++ G T+ RNS Sbjct: 139 AVLEHFSRLNLVLVNVGFCPTFVRNS 164 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 23.4 bits (48), Expect = 6.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 3 IELHISILFLIAEFLL*VSRTPKPSYIIL 89 + L ISIL + FLL VS+ P+ ++L Sbjct: 264 VTLGISILLSLVVFLLLVSKILPPTSLVL 292 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.0 bits (47), Expect = 9.1 Identities = 13/42 (30%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 374 LFALWQTVKFQIRI-KNDEFRQYLGSNPEDVYKEYTKDSYGW 496 L A ++++ IR+ KN+ F ++L S EDV + + + W Sbjct: 336 LLAARESLRKAIRLSKNEAFDRFLRSIREDVTGIFFRKVFHW 377 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,753 Number of Sequences: 2352 Number of extensions: 12566 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -