BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021268 (491 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14165| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_9322| Best HMM Match : RGS (HMM E-Value=0.037) 27 6.4 >SB_14165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1837 Score = 27.9 bits (59), Expect = 4.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -1 Query: 389 PFKTCFQSDSASCCQIDIASETSQRPNPPF 300 P T Q+D A C+ID S ++ NPP+ Sbjct: 976 PRVTNSQTDQALACEIDNRSRSTSEINPPY 1005 >SB_9322| Best HMM Match : RGS (HMM E-Value=0.037) Length = 1068 Score = 27.5 bits (58), Expect = 6.4 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -1 Query: 386 FKTCFQSDSASCCQID---IASETSQRPNPPFQGTEALLVFIQVKN 258 +KT F S S C + +AS S+RP+ P V +KN Sbjct: 790 YKTYFDSSSRRCVSLPSLLVASVESERPSSPVMAEAQQAVLNDIKN 835 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,050,176 Number of Sequences: 59808 Number of extensions: 195502 Number of successful extensions: 309 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 293 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 309 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -