BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021268 (491 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY094724-1|AAM11077.1| 788|Drosophila melanogaster GH21171p pro... 29 4.5 AE014134-3368|AAF53983.2| 2759|Drosophila melanogaster CG8677-PA... 29 4.5 >AY094724-1|AAM11077.1| 788|Drosophila melanogaster GH21171p protein. Length = 788 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 Query: 424 CSDHGSNPSSLIHLKLVFSQTPRAVARLILRQ 329 C ++GS P+S HL LV S A A L Q Sbjct: 230 CGNYGSGPNSAQHLPLVMSMPSAAAAAAHLMQ 261 >AE014134-3368|AAF53983.2| 2759|Drosophila melanogaster CG8677-PA protein. Length = 2759 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 Query: 424 CSDHGSNPSSLIHLKLVFSQTPRAVARLILRQ 329 C ++GS P+S HL LV S A A L Q Sbjct: 2201 CGNYGSGPNSAQHLPLVMSMPSAAAAAAHLMQ 2232 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,493,101 Number of Sequences: 53049 Number of extensions: 296595 Number of successful extensions: 641 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 641 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1721789184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -