BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021266 (595 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 23 1.5 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 23 1.9 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 22 4.5 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 7.8 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 21 7.8 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 7.8 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 7.8 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 23.4 bits (48), Expect = 1.5 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = +1 Query: 4 PSPDPIVIEQPSSNVSKHHQVQNQAYLTPAH--PEKPPSPSKQG*NPVRLLPPAFQMLRP 177 P P P +S + +Q N YL A P+ P +QG N RLL P+ ++ P Sbjct: 205 PFPPPYPFYPGTSAMLAAYQRYNP-YLQAASMLPKPTPLVPQQGFNMERLLAPSTEVSAP 263 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 23.0 bits (47), Expect = 1.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 513 FELSRLLSPWRTSQHH 560 F LS +SP+ +SQHH Sbjct: 39 FPLSLGMSPYASSQHH 54 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 162 PNVATLSGPSEASKPDAPPNPLSS 233 P+++T P E PPNPL + Sbjct: 334 PHISTGFSPYEILYGRTPPNPLDA 357 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.0 bits (42), Expect = 7.8 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 537 PWRTSQHHRP 566 PW+T +HRP Sbjct: 527 PWQTVYNHRP 536 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.0 bits (42), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 241 VGSELKGLGGASGFE 197 +GS G GG+SG++ Sbjct: 157 IGSSQLGTGGSSGYQ 171 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 241 VGSELKGLGGASGFE 197 +GS G GG+SG++ Sbjct: 317 IGSSQLGTGGSSGYQ 331 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 7.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -1 Query: 241 VGSELKGLGGASGFE 197 +GS G GG+SG++ Sbjct: 317 IGSSQLGTGGSSGYQ 331 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,424 Number of Sequences: 336 Number of extensions: 2771 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -