BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021266 (595 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 25 0.56 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 3.9 X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. 22 5.2 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 5.2 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 6.9 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 6.9 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 6.9 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 6.9 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 6.9 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 6.9 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 6.9 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 6.9 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 6.9 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 6.9 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 6.9 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 6.9 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 6.9 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 6.9 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 6.9 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 6.9 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 9.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.1 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 25.0 bits (52), Expect = 0.56 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 492 CSELKP*ERSKGPSRRESGKRVQR 421 C P R PSR+ESG+R +R Sbjct: 389 CVACSPPPRQTPPSRKESGRRRRR 412 Score = 21.8 bits (44), Expect = 5.2 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +1 Query: 25 IEQPSSNVSKHHQVQNQAYLTPAHPEKPPSPSKQG 129 I +PS N + H + +P + PPS + G Sbjct: 373 IPEPSKNPAMGHWQMSCVACSPPPRQTPPSRKESG 407 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.2 bits (45), Expect = 3.9 Identities = 7/19 (36%), Positives = 15/19 (78%) Frame = -3 Query: 389 RLEQKQQEDRAEQGKEALT 333 ++ +K++ED ++GKE+ T Sbjct: 209 KVPEKKKEDEIDEGKESKT 227 >X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. Length = 103 Score = 21.8 bits (44), Expect = 5.2 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 503 ELRGVLS*SLESVLRD 456 E RGVL LE+V+RD Sbjct: 54 ETRGVLKVFLENVIRD 69 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 5.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 4 PSPDPIVIEQPSSNVS 51 PSP+P + PSS+ S Sbjct: 511 PSPNPRIASAPSSSTS 526 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 129 PPRFIPPDMYRLRPPPNPR 147 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 129 PPRFIPPDMYRLRPPPNPR 147 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 129 PPRFIPPDMYRLRPPPNPR 147 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 129 PPRFIPPDMYRLRPPPNPR 147 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 129 PPRFIPPDMYRLRPPPNPR 147 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 129 PPRFIPPDMYRLRPPPNPR 147 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 129 PPRFIPPDMYRLRPPPNPR 147 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 378 PPRFIPPDMYRLRPPPNPR 396 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 378 PPRFIPPDMYRLRPPPNPR 396 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 378 PPRFIPPDMYRLRPPPNPR 396 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 378 PPRFIPPDMYRLRPPPNPR 396 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 378 PPRFIPPDMYRLRPPPNPR 396 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 378 PPRFIPPDMYRLRPPPNPR 396 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 377 PPRFIPPDMYRLRPPPNPR 395 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 362 PPRFIPPDMYRLRPPPNPR 380 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 136 PVRLLPPAFQMLRP*AAPR 192 P R +PP LRP PR Sbjct: 378 PPRFIPPDMYRLRPPPNPR 396 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +3 Query: 165 NVATLSGPSEASKPDAPPNP 224 N LSG S+ S PP P Sbjct: 369 NAMLLSGRSQKSTTGPPPGP 388 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 359 PCLLVAFAQASNSTPQRVWA 418 P + + + A N TPQ WA Sbjct: 437 PAVSLKCSAAGNPTPQVTWA 456 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 359 PCLLVAFAQASNSTPQRVWA 418 P + + + A N TPQ WA Sbjct: 437 PAVSLKCSAAGNPTPQVTWA 456 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,833 Number of Sequences: 438 Number of extensions: 3432 Number of successful extensions: 26 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -