BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021261 (705 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 1.8 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 21 7.4 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 21 7.4 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 9.8 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.4 bits (48), Expect = 1.8 Identities = 13/54 (24%), Positives = 23/54 (42%) Frame = +2 Query: 323 SLTLKSVTSVTFTTVHWKT*KLYVHGSSRRRVTTYNWIRPRYCRARPLRMFTWK 484 SL+L S +++ + W + HG R +W+ Y R + T+K Sbjct: 362 SLSLASAQTLSELDLSWNSISSLSHGGQLARFKCLSWLDLSYNRLGQIDAGTFK 415 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -3 Query: 127 WFFNCFSCSGVSLLYLSFLHEIIIDRH 47 WF NC + V++ + LH+ + R+ Sbjct: 225 WFINCTAKGRVAVWMCNNLHKALESRN 251 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -3 Query: 127 WFFNCFSCSGVSLLYLSFLHEIIIDRH 47 WF NC + V++ + LH+ + R+ Sbjct: 225 WFINCTAKGRVAVWMCNNLHKALESRN 251 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -3 Query: 496 SSARLPCEHP*WPRSAVTW 440 S A + C+ +PR VTW Sbjct: 714 SDAAVECKADGFPRPVVTW 732 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,927 Number of Sequences: 336 Number of extensions: 3461 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -