BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021261 (705 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 24 1.2 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 24 1.6 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 3.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.7 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 6.5 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = +1 Query: 268 DIWNFARQNGFQVYVCTMELDPQVCYKRNIHNRTL 372 D+ NF+ + + Y C E P + Y+ + R + Sbjct: 180 DLVNFSARRNVEYYSCCPEPYPDITYEIRLRRRPM 214 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.8 bits (49), Expect = 1.6 Identities = 11/38 (28%), Positives = 24/38 (63%) Frame = -1 Query: 231 IRNEKYPSVMLLLNALFNEFTYDSSQSLSNSYFRVGFL 118 ++ + SV LL+ +F+ +TYD+ L+ ++ +GF+ Sbjct: 483 VKGDVAGSVEALLD-IFDTYTYDTICQLNIVHYGIGFI 519 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.6 bits (46), Expect = 3.7 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -3 Query: 373 PVYGCECYACN 341 P GCEC CN Sbjct: 431 PPIGCECKTCN 441 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +3 Query: 357 SQPYTGRHRNYMYTVLPDAESPHTTGSDHVTAERGHYGCSH 479 ++P G++RNY L +A G V +YG H Sbjct: 1033 TRPKRGKYRNYDRDSLVEAVRAVQRGEMSVHRAGSYYGVPH 1073 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 6.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 504 AEIHEKLSETRRNQQTA 554 AE+H + ET RN+ A Sbjct: 1125 AEVHNRSRETARNRMAA 1141 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,476 Number of Sequences: 438 Number of extensions: 4286 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -