BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021260X (428 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 21 3.8 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 5.0 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 21 5.0 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 21 5.0 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 6.6 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 6.6 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 21.4 bits (43), Expect = 3.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 330 DRTYEYHHHGHAEFGRQHVRYPMIRPGLVTS 238 + +++ H+G A Q R RPG+VT+ Sbjct: 22 EHPHQHQHYGAAVQVPQGGRRRAARPGVVTT 52 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.0 bits (42), Expect = 5.0 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +3 Query: 138 PVRVQGAHTSGPGQ*CSRFYVQELEAAL 221 PVR+ G H G C++ E AL Sbjct: 196 PVRIMGVHRPGFDNDCNKNTSTSKEIAL 223 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.0 bits (42), Expect = 5.0 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 66 IGSPTFSVGVFRKERDGAGCSQAPPVRVQGAHTSGP 173 +G P + G K + + S PP+ + GA +GP Sbjct: 287 LGIPAY--GRAWKMDEDSSISGVPPLSIDGALEAGP 320 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 21.0 bits (42), Expect = 5.0 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = +2 Query: 269 YRTCCRPNSACPWWW 313 YR C RP WW Sbjct: 256 YRYCYRPYPVYNQWW 270 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 20.6 bits (41), Expect = 6.6 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +2 Query: 251 PGRIMGYRTCCRPNSACPW 307 PG + +TC R + PW Sbjct: 506 PGETINLQTCVRCPNNYPW 524 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = -3 Query: 336 HPDRTYEYHHHGH 298 HP T+ YH + H Sbjct: 158 HPGMTFRYHFNVH 170 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,185 Number of Sequences: 336 Number of extensions: 2182 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9460170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -