BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021260X (428 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein ... 25 1.1 AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding pr... 24 2.6 AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding pr... 24 2.6 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 3.5 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 23 3.5 AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein prot... 23 6.1 >AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein protein. Length = 168 Score = 25.0 bits (52), Expect = 1.1 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +3 Query: 231 QGGWSPNQAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 362 QGG S+G+G+ +P + G G +SG +FGN +GG Sbjct: 121 QGG-GQGGIPSFGSGQQNGGVPFL-GNGQGQSGFPSFGNGQQGG 162 >AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding protein AgamOBP31 protein. Length = 313 Score = 23.8 bits (49), Expect = 2.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 153 GAHTSGPGQ*CSRFYVQELEAALLR 227 G +T+ G SRFYV++LE LR Sbjct: 199 GLYTTESGIHLSRFYVRDLEVNDLR 223 >AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding protein 1 protein. Length = 304 Score = 23.8 bits (49), Expect = 2.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 153 GAHTSGPGQ*CSRFYVQELEAALLR 227 G +T+ G SRFYV++LE LR Sbjct: 199 GLYTTESGIHLSRFYVRDLEVNDLR 223 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 3.5 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -3 Query: 342 RRHPDRTYEYHHHGH 298 ++HP + +HHH H Sbjct: 175 QQHPGHSQHHHHHHH 189 Score = 22.6 bits (46), Expect = 6.1 Identities = 9/36 (25%), Positives = 14/36 (38%) Frame = -3 Query: 360 HHDTCYRRHPDRTYEYHHHGHAEFGRQHVRYPMIRP 253 +H + H + +HHH +QH P P Sbjct: 172 YHQQQHPGHSQHHHHHHHHHPHHSQQQHSASPRCYP 207 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.4 bits (48), Expect = 3.5 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 111 DGAGCSQAPPVRVQGAHTSGPG 176 DG +PP+ V G+ S PG Sbjct: 153 DGLHSIPSPPITVSGSDMSSPG 174 >AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein protein. Length = 385 Score = 22.6 bits (46), Expect = 6.1 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = -1 Query: 122 PCTVSLFSEYTDTKGRATDRLHFATLAKLYLRNIH 18 P T L +E + GR +++ +++ + +NIH Sbjct: 347 PATAGLVTEVQNIFGRYKKGMNYKSISHIIGKNIH 381 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 452,455 Number of Sequences: 2352 Number of extensions: 9864 Number of successful extensions: 38 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35292513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -