BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021257 (844 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1398 - 33245268-33245876,33247516-33247608,33247639-332478... 29 3.5 11_01_0307 + 2304500-2306023 29 4.6 12_02_0280 - 16729000-16729678,16729948-16730039,16730072-167307... 28 8.1 09_06_0048 + 20477076-20478547,20478643-20478722,20478880-204788... 28 8.1 07_01_1146 + 10756897-10757065,10763869-10765521,10765638-107659... 28 8.1 06_01_0290 + 2122758-2123015,2123128-2123544 28 8.1 04_04_0824 - 28399144-28399385,28400193-28400312,28400422-284004... 28 8.1 02_03_0220 + 16545571-16545573,16545717-16545818,16545980-165460... 28 8.1 02_01_0682 + 5064127-5065170,5066234-5066317 28 8.1 01_01_0573 + 4253484-4254653,4255526-4255735,4255842-4255937,425... 28 8.1 >04_04_1398 - 33245268-33245876,33247516-33247608,33247639-33247827, 33248146-33248496 Length = 413 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 432 KSPSC-ELGGPGSLKSERLSSDSNDILIHRQASEAR 536 K PS E G GS R SDS+D +HR A ++R Sbjct: 285 KRPSATESGTSGSSSKSRTCSDSSDEALHRLADDSR 320 >11_01_0307 + 2304500-2306023 Length = 507 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = -2 Query: 318 SSHDACLLVLSSAPPEWAATPRRTGTVAR---LSRVTGLVL 205 +S D ++ L+S+ P W ATP R G +R L+ TGLVL Sbjct: 77 ASLDLAVVHLASSFPVWRATPARVGDWSRPATLTFDTGLVL 117 >12_02_0280 - 16729000-16729678,16729948-16730039,16730072-16730772, 16731033-16731144,16731961-16731970,16732954-16733663 Length = 767 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +3 Query: 312 VKIEPHSQPSGEDSASDLGVDGIKTEIDGLMDSDGKSDPTK 434 V+I+P E + + +G+DG + EI + +G+S PT+ Sbjct: 104 VEIDPRLPALYEAAKNLVGIDGPREEISRWLTEEGQSGPTQ 144 >09_06_0048 + 20477076-20478547,20478643-20478722,20478880-20478893, 20480164-20481199,20481275-20481402,20481673-20481732, 20481774-20481878,20481971-20482055,20482315-20482470, 20482562-20482831,20482877-20483671,20483844-20483903, 20484062-20485134 Length = 1777 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 Query: 315 KIEPHSQPSGEDSASDLGVDGIKTEIDGLMDSDGKSD 425 K E + P+G +SA + G+ G D DGK+D Sbjct: 362 KAEKEAAPAGNNSADEEGMQMDAVTTTGAEDEDGKAD 398 >07_01_1146 + 10756897-10757065,10763869-10765521,10765638-10765900, 10766057-10766266,10766818-10767036,10767379-10768344, 10768575-10768670,10768772-10768870,10769349-10769538, 10769623-10769855 Length = 1365 Score = 28.3 bits (60), Expect = 8.1 Identities = 25/59 (42%), Positives = 29/59 (49%), Gaps = 6/59 (10%) Frame = +3 Query: 354 ASDLGVDGIKTEIDGLMDSDGKSDPTKSPSCELGG-----PGSLKSERLSS-DSNDILI 512 ASD+ ++ + I D DPTK PS LGG P LKSE SS D ND I Sbjct: 187 ASDVDLEDLGLNIFW-KKGDKHPDPTKLPSYTLGGGICTFPDFLKSEIKSSIDFNDASI 244 >06_01_0290 + 2122758-2123015,2123128-2123544 Length = 224 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 414 GKSDPTKSPSCELGGPGSLKSERLSSDSNDIL 509 G D C++GG G+ K RLS D +L Sbjct: 43 GSGDEVDDAGCDVGGGGARKKLRLSKDQAAVL 74 >04_04_0824 - 28399144-28399385,28400193-28400312,28400422-28400453, 28400531-28400625,28400713-28400786,28400883-28401018, 28401096-28401333,28401508-28401555,28401593-28401780, 28401862-28401983,28402061-28402226,28402321-28402443, 28403068-28403139,28403244-28403351,28404212-28404328, 28404458-28404596,28404702-28404808,28404904-28405013, 28405141-28405274,28405348-28405497,28405571-28405791, 28405868-28406677,28410261-28410473 Length = 1254 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 166 MIKEKEKGGGARLKDEPSDPAEPGHGS 246 M+K+K G G+ + P PGHGS Sbjct: 82 MVKKKRTGSGSTGESSGEAPGAPGHGS 108 >02_03_0220 + 16545571-16545573,16545717-16545818,16545980-16546008, 16549421-16553036 Length = 1249 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -3 Query: 593 CYLGHLDYDSLGFHPEDYLSSF*G-LSVDQNVV 498 C+LGH+ Y+SLG D L S G L NVV Sbjct: 996 CHLGHILYESLGEEYPDVLGSILGALKAIVNVV 1028 >02_01_0682 + 5064127-5065170,5066234-5066317 Length = 375 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +1 Query: 610 GGRWRAYGSGVSMGPMSASE--AQTLPSNVMSKQSGS 714 GG+ R G+G+SM P AS+ ++LP +S++ S Sbjct: 236 GGQVREAGAGMSMRPSRASQLVVESLPEATLSEEEAS 272 >01_01_0573 + 4253484-4254653,4255526-4255735,4255842-4255937, 4256034-4256255,4256829-4257023,4257097-4257243, 4257323-4257472,4257762-4257892,4257978-4258194 Length = 845 Score = 28.3 bits (60), Expect = 8.1 Identities = 17/74 (22%), Positives = 35/74 (47%), Gaps = 3/74 (4%) Frame = -1 Query: 547 KIICRASEACLWIKMSFESEDSLSDFNEPGPPSS---QEGDFVGSLLPSLSMRPSISVLM 377 K+I + SEA +W++ + +D+L P SS ++ + V + M+P + Sbjct: 730 KVINQCSEAEVWLREKIQQQDALPKHANPVLLSSDLKKKAETVDRFCKPIMMKPKPAPKP 789 Query: 376 PSTPRSDAESSPEG 335 + P++ +P G Sbjct: 790 QTPPQTPPTETPAG 803 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,063,580 Number of Sequences: 37544 Number of extensions: 524184 Number of successful extensions: 1674 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1674 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2338704516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -