BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021257 (844 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y13620-1|CAA73942.1| 1394|Homo sapiens B-cell CLL/lymphoma 9 pro... 42 0.004 BC116451-1|AAI16452.1| 1426|Homo sapiens B-cell CLL/lymphoma 9 p... 42 0.004 AL359207-1|CAI15198.1| 1426|Homo sapiens B-cell CLL/lymphoma 9 p... 42 0.004 AY296059-1|AAQ62697.1| 1494|Homo sapiens BCL9-2 protein. 38 0.034 AB094091-1|BAC76045.1| 1499|Homo sapiens DLNB11 protein. 38 0.034 >Y13620-1|CAA73942.1| 1394|Homo sapiens B-cell CLL/lymphoma 9 protein. Length = 1394 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +1 Query: 730 IFVFSTMMANKGAEAVLSGQHHSIIAYHCAQPATKK 837 ++VFST MANK AEAVL GQ +I+++H + K Sbjct: 177 VYVFSTEMANKAAEAVLKGQVETIVSFHIQNISNNK 212 >BC116451-1|AAI16452.1| 1426|Homo sapiens B-cell CLL/lymphoma 9 protein. Length = 1426 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +1 Query: 730 IFVFSTMMANKGAEAVLSGQHHSIIAYHCAQPATKK 837 ++VFST MANK AEAVL GQ +I+++H + K Sbjct: 177 VYVFSTEMANKAAEAVLKGQVETIVSFHIQNISNNK 212 >AL359207-1|CAI15198.1| 1426|Homo sapiens B-cell CLL/lymphoma 9 protein. Length = 1426 Score = 41.5 bits (93), Expect = 0.004 Identities = 18/36 (50%), Positives = 25/36 (69%) Frame = +1 Query: 730 IFVFSTMMANKGAEAVLSGQHHSIIAYHCAQPATKK 837 ++VFST MANK AEAVL GQ +I+++H + K Sbjct: 177 VYVFSTEMANKAAEAVLKGQVETIVSFHIQNISNNK 212 >AY296059-1|AAQ62697.1| 1494|Homo sapiens BCL9-2 protein. Length = 1494 Score = 38.3 bits (85), Expect = 0.034 Identities = 16/28 (57%), Positives = 22/28 (78%) Frame = +1 Query: 730 IFVFSTMMANKGAEAVLSGQHHSIIAYH 813 ++VF+T +AN AEAVL G+ SI+AYH Sbjct: 235 VYVFTTHLANTAAEAVLQGRADSILAYH 262 >AB094091-1|BAC76045.1| 1499|Homo sapiens DLNB11 protein. Length = 1499 Score = 38.3 bits (85), Expect = 0.034 Identities = 16/28 (57%), Positives = 22/28 (78%) Frame = +1 Query: 730 IFVFSTMMANKGAEAVLSGQHHSIIAYH 813 ++VF+T +AN AEAVL G+ SI+AYH Sbjct: 240 VYVFTTHLANTAAEAVLQGRADSILAYH 267 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,028,155 Number of Sequences: 237096 Number of extensions: 2800614 Number of successful extensions: 10658 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10054 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10658 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10649685938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -