BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021256 (715 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC887.10 |mcs4||two-component response regulator |Schizosaccha... 26 4.7 SPAC20G8.10c ||SPAC3A12.01c|beclin family protein|Schizosaccharo... 26 6.1 SPCC1259.11c |gyp2||GTPase activating protein Gyp2 |Schizosaccha... 26 6.1 SPAC869.01 |||amidase |Schizosaccharomyces pombe|chr 1|||Manual 25 8.1 >SPBC887.10 |mcs4||two-component response regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 522 Score = 26.2 bits (55), Expect = 4.7 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 608 DFGDLFLKVSPELLCLLQMKSNQQSNST 691 DF D L SP+ L+ +S+Q S+ST Sbjct: 86 DFNDALLVASPDTSVALRYRSSQLSSST 113 >SPAC20G8.10c ||SPAC3A12.01c|beclin family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 464 Score = 25.8 bits (54), Expect = 6.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 280 NSNFEHNFLRSENVQNSPLFRKVFY 206 N FEHN + E +Q +F +FY Sbjct: 259 NLEFEHNSRKLEKLQKMNVFSDIFY 283 >SPCC1259.11c |gyp2||GTPase activating protein Gyp2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 720 Score = 25.8 bits (54), Expect = 6.1 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 252 RRKLCSKLLFWLKSGGATKSPL 317 +RKL ++L W+K G +T++ L Sbjct: 577 KRKLFTRLYIWMKDGDSTETSL 598 >SPAC869.01 |||amidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 583 Score = 25.4 bits (53), Expect = 8.1 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +2 Query: 566 YMMSTAIMHQSALHDFGDLFLKVSPELLCLLQMKSNQQSNSTSADDE 706 YM + + +H + D +L+V+P + +LQ+ + + ++ DDE Sbjct: 77 YMENGILTSTDIVHCYLDRYLQVNPYVNGILQLNPDVLTIASELDDE 123 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,963,795 Number of Sequences: 5004 Number of extensions: 61588 Number of successful extensions: 178 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 178 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -