BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021256 (715 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 23 9.5 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 23 9.5 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +1 Query: 193 RKKGCKKLFETKDCFVH--FRCEGNCVQNYCFGLNLE 297 R++ ++ TK+C F+C G C Q C+G L+ Sbjct: 42 REQPEQRCVPTKECPPDEVFKCCGPCYQLNCYGTVLD 78 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 23.0 bits (47), Expect = 9.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 205 CKKLFETKDCFVHFRCEGNCVQ 270 C K+F+ + C + + NC Q Sbjct: 637 CIKVFDLRQCHLQMQSLANCAQ 658 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 737,715 Number of Sequences: 2352 Number of extensions: 14072 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -