BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021255 (760 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24530.1 68418.m02897 oxidoreductase, 2OG-Fe(II) oxygenase fa... 31 0.63 At1g69090.1 68414.m07906 F-box family protein contains F-box dom... 30 1.5 At1g55430.1 68414.m06340 DC1 domain-containing protein contains ... 30 1.9 At1g06250.1 68414.m00661 lipase class 3 family protein similar t... 29 2.5 At5g67570.1 68418.m08520 pentatricopeptide (PPR) repeat-containi... 29 3.4 At3g59660.1 68416.m06656 C2 domain-containing protein / GRAM dom... 29 3.4 At4g35520.1 68417.m05049 DNA mismatch repair family protein simi... 29 4.4 At2g41760.1 68415.m05162 expressed protein 28 5.9 At2g28810.1 68415.m03503 Dof-type zinc finger domain-containing ... 28 5.9 At4g03090.1 68417.m00417 expressed protein 28 7.7 At1g29720.1 68414.m03633 protein kinase family protein contains ... 28 7.7 >At5g24530.1 68418.m02897 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to flavanone 3-hydroxylase [Persea americana][GI:727410]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 341 Score = 31.5 bits (68), Expect = 0.63 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +3 Query: 450 YQQRWQSNFP-YHWKAERCSRARRQILTHFQQQASKQISIPKEHYRWILGKQGQKL 614 Y W SN P + + SR R++ ++ S+ + + K++ + +LG+QGQ + Sbjct: 137 YVNEWPSNPPSFKEIVSKYSREVREVGFKIEELISESLGLEKDYMKKVLGEQGQHM 192 >At1g69090.1 68414.m07906 F-box family protein contains F-box domain Pfam:PF00646 Length = 401 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +2 Query: 128 SMMVGDVIPVHPDVPMHVEEMNNVGYENNVSFAYDDLFPALPLPSPLCNVIYNRLQT-NF 304 ++ + D P + VGY N + YD+ FP +PL L IYN + T Sbjct: 229 NLYIYDFFGEFPREAFRISVREFVGYATN-PYGYDE-FPEVPLKLKLNRYIYNMIVTVRG 286 Query: 305 ELALHCTLKFSM 340 ++ + +L FSM Sbjct: 287 DVLIVASLHFSM 298 >At1g55430.1 68414.m06340 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 657 Score = 29.9 bits (64), Expect = 1.9 Identities = 21/85 (24%), Positives = 37/85 (43%), Gaps = 3/85 (3%) Frame = +2 Query: 143 DVIPVHPDVPMHVEEMNNVGYENNVSFAYDDLFPALPLPSPLCNVIYNRLQTNFELALHC 322 D +P D ++ V Y + S +Y + SPL + Y+ F L L C Sbjct: 147 DAVPNDDDNGGGGGDIYAVAYNDGASLSYGNHLKCKCCASPLEKLYYHCSTCKFNLNLTC 206 Query: 323 TLK---FSMCHMKNENLTMLILLVR 388 +++ ++ H+K T+ + LVR Sbjct: 207 SMRPPPTTISHLKFHEHTLTLFLVR 231 >At1g06250.1 68414.m00661 lipase class 3 family protein similar to lipase GB:AAD01804 GI:4103627 from [Dianthus caryophyllus]; contains Pfam profile PF01764: Lipase Length = 423 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = +2 Query: 89 QGLPEETKMMHQQSMMVGDVIPVHPDVP---MHVEEMNNVGYE 208 +G+P+ K++ Q+ G + P+ PD+ +H EM+ VGY+ Sbjct: 3 EGIPKRWKVLSGQNKWKGLLDPLDPDLRRYIIHYGEMSQVGYD 45 >At5g67570.1 68418.m08520 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 611 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 293 VACCILRCTRG-WEAAMLEIGHRRQMTHCSHIQ 198 +ACC+ C G W AMLE+G +++ +C ++ Sbjct: 452 LACCL--CNNGRWCDAMLEVGRMKRLENCRPLE 482 >At3g59660.1 68416.m06656 C2 domain-containing protein / GRAM domain-containing protein low similarity to GLUT4 vesicle protein [Rattus norvegicus] GI:4193489; contains Pfam profiles PF00168: C2 domain, PF02893: GRAM domain Length = 594 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -3 Query: 482 IRKVRLPSLLVDISMCAPVSLVMEWQVLKDSPSPKVLALSSFRSSY 345 +R+++ S+ + MC P + V EWQ + SP KVL + + + Sbjct: 457 VREIKFRSIC-NSPMCPPDTAVTEWQHVVLSPDKKVLVFETVQQPH 501 >At4g35520.1 68417.m05049 DNA mismatch repair family protein similar to SP|Q9UHC1 DNA mismatch repair protein Mlh3 (MutL protein homolog 3) {Homo sapiens}; contains Pfam profiles PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein, PF01119: DNA mismatch repair protein, C-terminal domain Length = 1151 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 337 HVPYEERKLDNANTFGEGESLRTCHSITKDTGAHIEISTSK 459 H+ E++L +A+ RT HS T+D H + S+ + Sbjct: 819 HIQETEKRLSSASDLKASAGCRTVHSETQDEDVHEDFSSEE 859 >At2g41760.1 68415.m05162 expressed protein Length = 221 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 233 DLFPALPLPSPLCNVIYNRLQTNFELALHCTLKFSMCH 346 DL LP PSPL + + +Q +F+L F + H Sbjct: 97 DLDSTLPFPSPLASYVTETIQPSFQLFAEYQRFFRIVH 134 >At2g28810.1 68415.m03503 Dof-type zinc finger domain-containing protein similar to zinc finger protein OBP2 GI:5059394 from [Arabidopsis thaliana] Length = 340 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 175 HGYIRMNGYHISNHHGLLMHHF 110 H ++ NG +S HH +L HHF Sbjct: 28 HHQLQENGSLVSGHHQVLSHHF 49 >At4g03090.1 68417.m00417 expressed protein Length = 877 Score = 27.9 bits (59), Expect = 7.7 Identities = 20/56 (35%), Positives = 26/56 (46%) Frame = +1 Query: 250 AASQPLVQRNIQQATNKLRVGSSLHTQVFHVPYEERKLDNANTFGEGESLRTCHSI 417 A+S V + QQA L+ LH+ H P+ ER N G+G LR SI Sbjct: 207 ASSVEEVNFHCQQAEAALQF---LHSLCQHKPFRERVAKNKELCGKGGVLRLAQSI 259 >At1g29720.1 68414.m03633 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 300 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/51 (23%), Positives = 27/51 (52%) Frame = +2 Query: 14 DPGVYGVIFQFDLIQYFCTVTTRRGQGLPEETKMMHQQSMMVGDVIPVHPD 166 DPG+YG + ++ T ++ G+ ++T + S+ D+ P++P+ Sbjct: 235 DPGIYGHDWSISKLRDIDTHSSSSTSGVTDQTTTTMKSSVSGCDLYPLYPE 285 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,712,880 Number of Sequences: 28952 Number of extensions: 330201 Number of successful extensions: 970 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 944 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 969 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -