BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021252X (543 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 21 5.3 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 5.3 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 7.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.0 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 7.0 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 7.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.0 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 21 9.2 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 9.2 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 9.2 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 21.4 bits (43), Expect = 5.3 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -1 Query: 231 PLYCNAPSRPGAPHYRH 181 PLY + AP YRH Sbjct: 330 PLYLKHEQQGAAPDYRH 346 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.4 bits (43), Expect = 5.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 440 RQHLTRWTSGQRPPYLSW 387 + HL RW +G+RP +W Sbjct: 333 KAHL-RWHTGERPFVCNW 349 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.0 bits (42), Expect = 7.0 Identities = 5/14 (35%), Positives = 9/14 (64%) Frame = +3 Query: 246 SLCRWCSAPTGYSW 287 +L +W + TG+ W Sbjct: 339 ALAKWANGQTGFPW 352 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 7.0 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = -1 Query: 345 LKARCWSSSRRRLYGFRAFTTSSQLVRNTICIGTPRPAPLYCNAPSRP 202 L R + + R LYG RA S + I R PL RP Sbjct: 43 LSDRSAAYTNRELYGTRALPLRSAVEHIPDLIADSRRLPLRDAVEKRP 90 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.0 bits (42), Expect = 7.0 Identities = 5/15 (33%), Positives = 11/15 (73%) Frame = +1 Query: 208 RRRITVKRSWARCPY 252 +++I K+ W++C Y Sbjct: 114 KKKIRAKKRWSQCMY 128 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 7.0 Identities = 5/15 (33%), Positives = 11/15 (73%) Frame = +1 Query: 208 RRRITVKRSWARCPY 252 +++I K+ W++C Y Sbjct: 428 KKKIRAKKRWSQCMY 442 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 7.0 Identities = 5/15 (33%), Positives = 11/15 (73%) Frame = +1 Query: 208 RRRITVKRSWARCPY 252 +++I K+ W++C Y Sbjct: 661 KKKIRAKKRWSQCMY 675 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 7.0 Identities = 5/15 (33%), Positives = 11/15 (73%) Frame = +1 Query: 208 RRRITVKRSWARCPY 252 +++I K+ W++C Y Sbjct: 661 KKKIRAKKRWSQCMY 675 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 243 PRPAPLYCNAP 211 PRPAP NAP Sbjct: 258 PRPAPASRNAP 268 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 458 PLERRQRQHLTRWTSGQ 408 PL+R+QR+ T +T+ Q Sbjct: 215 PLKRKQRRSRTTFTAHQ 231 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -1 Query: 153 NSLGPD*NSSSLCHCSSG 100 N D +S CHCS G Sbjct: 158 NGTCEDIGNSHRCHCSDG 175 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,164 Number of Sequences: 336 Number of extensions: 2704 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13306679 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -