Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV021249
         (654 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A5K647 Cluster: Phosphatidylinositol 3-and 4-kinase, pu...    33   6.0  

>UniRef50_A5K647 Cluster: Phosphatidylinositol 3-and 4-kinase,
            putative; n=4; cellular organisms|Rep:
            Phosphatidylinositol 3-and 4-kinase, putative -
            Plasmodium vivax
          Length = 4367

 Score = 33.1 bits (72), Expect = 6.0
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 5/65 (7%)
 Frame = +3

Query: 111  VIFHREHFKQFCVFNQNVFVITVILNLAQHILNVDDLTTYSTY--STI---NYKFW*MHL 275
            V++H++H K++   N   FVI+V L+   + LNVD L     Y  S I   N+KF+  + 
Sbjct: 1733 VLYHKKHIKEY--MNVINFVISVFLSTNINNLNVDTLNNNYIYIFSKIIKKNFKFYFFYF 1790

Query: 276  EFSIY 290
             ++I+
Sbjct: 1791 YYNIF 1795


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 475,453,118
Number of Sequences: 1657284
Number of extensions: 7937597
Number of successful extensions: 12075
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 11715
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12075
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 49173558301
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)