BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021249 (654 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT015237-1|AAT94466.1| 1044|Drosophila melanogaster RE03681p pro... 30 3.2 AY058669-1|AAL13898.1| 1032|Drosophila melanogaster LD37985p pro... 30 3.2 AE014296-44|AAN11426.1| 1032|Drosophila melanogaster CG16940-PB,... 30 3.2 AE014296-43|AAF47351.2| 1032|Drosophila melanogaster CG16940-PA,... 30 3.2 AE014296-42|AAN11425.1| 1044|Drosophila melanogaster CG16940-PC,... 30 3.2 >BT015237-1|AAT94466.1| 1044|Drosophila melanogaster RE03681p protein. Length = 1044 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +3 Query: 129 HFKQFCVFNQNVFVITVILNLAQHILNVDDLTTYSTYSTINYK 257 +FK++ Q +++ V++ + QH++NV L + S INYK Sbjct: 947 YFKRYVHNKQGIYMRAVVIEIFQHMMNVVTLESGHVIS-INYK 988 >AY058669-1|AAL13898.1| 1032|Drosophila melanogaster LD37985p protein. Length = 1032 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +3 Query: 129 HFKQFCVFNQNVFVITVILNLAQHILNVDDLTTYSTYSTINYK 257 +FK++ Q +++ V++ + QH++NV L + S INYK Sbjct: 935 YFKRYVHNKQGIYMRAVVIEIFQHMMNVVTLESGHVIS-INYK 976 >AE014296-44|AAN11426.1| 1032|Drosophila melanogaster CG16940-PB, isoform B protein. Length = 1032 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +3 Query: 129 HFKQFCVFNQNVFVITVILNLAQHILNVDDLTTYSTYSTINYK 257 +FK++ Q +++ V++ + QH++NV L + S INYK Sbjct: 935 YFKRYVHNKQGIYMRAVVIEIFQHMMNVVTLESGHVIS-INYK 976 >AE014296-43|AAF47351.2| 1032|Drosophila melanogaster CG16940-PA, isoform A protein. Length = 1032 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +3 Query: 129 HFKQFCVFNQNVFVITVILNLAQHILNVDDLTTYSTYSTINYK 257 +FK++ Q +++ V++ + QH++NV L + S INYK Sbjct: 935 YFKRYVHNKQGIYMRAVVIEIFQHMMNVVTLESGHVIS-INYK 976 >AE014296-42|AAN11425.1| 1044|Drosophila melanogaster CG16940-PC, isoform C protein. Length = 1044 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +3 Query: 129 HFKQFCVFNQNVFVITVILNLAQHILNVDDLTTYSTYSTINYK 257 +FK++ Q +++ V++ + QH++NV L + S INYK Sbjct: 947 YFKRYVHNKQGIYMRAVVIEIFQHMMNVVTLESGHVIS-INYK 988 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,279,328 Number of Sequences: 53049 Number of extensions: 357296 Number of successful extensions: 550 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2786177250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -