BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021248 (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 60 1e-09 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 59 4e-09 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 56 2e-08 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 52 3e-07 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 49 4e-06 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 44 8e-05 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 44 1e-04 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 41 8e-04 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 38 0.009 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 36 0.021 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 36 0.021 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.066 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.087 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.087 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 34 0.11 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 33 0.20 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 33 0.20 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 33 0.20 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 33 0.26 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 30 1.4 SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 29 3.3 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 29 4.3 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 7.5 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 74.9 bits (176), Expect = 5e-14 Identities = 31/84 (36%), Positives = 50/84 (59%) Frame = +2 Query: 257 QPFNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKT 436 +PFNKNFY+ HP + K+S E+++ R K + VSG P F F + + ++ Sbjct: 475 KPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDEQMMASIRK 534 Query: 437 MGYKEPTPIQAQGWPIAMSGKNLV 508 + Y +PT IQ Q PIA+SG++++ Sbjct: 535 LEYTQPTQIQCQALPIALSGRDII 558 Score = 65.7 bits (153), Expect = 3e-11 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = +3 Query: 513 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 ++TGSGKT A++ PA+VHI +QP ++ GDGPI L+ APTREL QQ Sbjct: 561 AKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQ 605 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 61.7 bits (143), Expect = 5e-10 Identities = 30/86 (34%), Positives = 49/86 (56%), Gaps = 1/86 (1%) Frame = +2 Query: 257 QPFNKNFYDPHPTVLKRSPYEVEEYRNKHE-VTVSGVEVHNPIQYFEEANFPDYVQQGVK 433 QPF K+FY P + K +P E +E+R E + V G P++ + + + +K Sbjct: 62 QPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILDVLK 121 Query: 434 TMGYKEPTPIQAQGWPIAMSGKNLVA 511 Y++PTPIQAQ P+ MSG++++A Sbjct: 122 KNSYEKPTPIQAQAIPVIMSGRDMIA 147 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 Query: 531 KTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 K +Y P + P I G IA+V+ PTRELA Q Sbjct: 121 KKNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQ 159 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = +2 Query: 305 RSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 472 R +EV+ YR ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 Score = 58.8 bits (136), Expect = 4e-09 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 543 YILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 +ILP IVHIN+QP ++ GDGPI LVL PTRELAQQ Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQ 147 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 58.8 bits (136), Expect = 4e-09 Identities = 25/77 (32%), Positives = 45/77 (58%) Frame = +2 Query: 278 YDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 457 Y HPT+ + +V++ R+K E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 458 PIQAQGWPIAMSGKNLV 508 PIQ Q P+ +SG++++ Sbjct: 221 PIQMQVLPVLLSGRDVM 237 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 56.0 bits (129), Expect = 2e-08 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +3 Query: 513 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 ++TGSGKTLAY LP + + + P GD P+AL+L PTREL QQ Sbjct: 116 AETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQ 160 Score = 50.4 bits (115), Expect = 1e-06 Identities = 24/82 (29%), Positives = 43/82 (52%) Frame = +2 Query: 263 FNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 442 F ++YD + V + S V+E R K+ + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 443 YKEPTPIQAQGWPIAMSGKNLV 508 ++ PTPIQ Q MSG++++ Sbjct: 92 FQVPTPIQMQSLSCVMSGRDII 113 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 52.4 bits (120), Expect = 3e-07 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 4/49 (8%) Frame = +3 Query: 513 SQTGSGKTLAYILPAIVHINNQPPIRRGD----GPIALVLAPTRELAQQ 647 ++TGSGKT A+ +P +V I P I R + GP AL+LAPTRELAQQ Sbjct: 145 AETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQ 193 Score = 50.8 bits (116), Expect = 9e-07 Identities = 20/60 (33%), Positives = 36/60 (60%) Frame = +2 Query: 329 YRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 508 +R ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + ++++ Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDII 142 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 48.8 bits (111), Expect = 4e-06 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 4/64 (6%) Frame = +2 Query: 317 EVEEYRNKHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 484 ++ +R++ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Query: 485 AMSG 496 G Sbjct: 197 MAHG 200 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +3 Query: 513 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 +QTGSGKT AY+LP + + Q P+AL +APTRELA+Q Sbjct: 523 AQTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQ 567 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = +2 Query: 353 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 511 VSG I F E F + + + GY+ PTP+Q PI M+G++L+A Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMA 521 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 44.4 bits (100), Expect = 8e-05 Identities = 24/63 (38%), Positives = 37/63 (58%) Frame = +2 Query: 323 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 502 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++ Sbjct: 692 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRD 750 Query: 503 LVA 511 ++A Sbjct: 751 VMA 753 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = +3 Query: 513 SQTGSGKTLAYILPAIVHINN----QPPIRRGDGPIALVLAPTRELAQQ 647 +QTGSGKT A++LP + + N P A+ +APTRELA Q Sbjct: 755 AQTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQ 803 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 44.4 bits (100), Expect = 8e-05 Identities = 24/63 (38%), Positives = 37/63 (58%) Frame = +2 Query: 323 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKN 502 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI ++G++ Sbjct: 115 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRD 173 Query: 503 LVA 511 ++A Sbjct: 174 VMA 176 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/47 (44%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +3 Query: 510 RSQTGSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELAQQ 647 +++TG+GKTL++ LP + + + + +RG P LV+APTRELA+Q Sbjct: 116 QARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQ 162 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 41.1 bits (92), Expect = 8e-04 Identities = 23/45 (51%), Positives = 31/45 (68%) Frame = +3 Query: 513 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 ++TGSGKTLA+++P I + Q DG ALV++PTRELA Q Sbjct: 94 AKTGSGKTLAFLIPIIETLWRQKWTSM-DGLGALVISPTRELAYQ 137 Score = 31.9 bits (69), Expect = 0.46 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 380 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLV 508 ++ F + G+ G+ PT IQ QG P+A+SG++++ Sbjct: 49 VEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVL 91 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 37.9 bits (84), Expect = 0.007 Identities = 21/47 (44%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = +3 Query: 510 RSQTGSGKTLAYILPAIVHINNQPPIRRG-DGPIALVLAPTRELAQQ 647 ++Q+G+GKT + + + I+ + G D ALVLAPTRELAQQ Sbjct: 128 QAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQ 174 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 37.5 bits (83), Expect = 0.009 Identities = 23/50 (46%), Positives = 29/50 (58%), Gaps = 5/50 (10%) Frame = +3 Query: 513 SQTGSGKTLAYILPAIVHINNQPPIRRG-----DGPIALVLAPTRELAQQ 647 +QTGSGKTLAY+ P +VH + R G P A ++ P RELA Q Sbjct: 422 AQTGSGKTLAYLAP-LVHRLREDEERHGILARLKRPRACIVVPARELATQ 470 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 37.5 bits (83), Expect = 0.009 Identities = 17/45 (37%), Positives = 32/45 (71%) Frame = +3 Query: 513 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 ++TGSGKTLA+++P +V + + + +G ++++PTREL+ Q Sbjct: 616 AKTGSGKTLAFLVP-VVELLYKLQFKTRNGTGVIIISPTRELSLQ 659 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 36.3 bits (80), Expect = 0.021 Identities = 21/47 (44%), Positives = 32/47 (68%) Frame = +3 Query: 507 LRSQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 ++S+TG+GK+L ++LP++ Q P RG G I ++ PTRELA Q Sbjct: 202 IKSETGTGKSLVFLLPSV-----QDP-GRGYGTI--IVVPTRELASQ 240 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 36.3 bits (80), Expect = 0.021 Identities = 21/45 (46%), Positives = 28/45 (62%) Frame = +3 Query: 513 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 ++TGSGKT A+ LP + + + P G A+VL PTRELA Q Sbjct: 51 AKTGSGKTAAFALPILQKLCDDP-----YGIFAVVLTPTRELAFQ 90 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 34.7 bits (76), Expect = 0.066 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 14/59 (23%) Frame = +3 Query: 513 SQTGSGKTLAYILPAIVHIN-------NQPPI-------RRGDGPIALVLAPTRELAQQ 647 ++TGSGKTLA+ +P I HI Q P +G +AL++APTRELA Q Sbjct: 175 AETGSGKTLAFGIPIIQHIEAYKKRKAEQSPSDKESDLESQGYPLLALIMAPTRELALQ 233 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 34.3 bits (75), Expect = 0.087 Identities = 20/46 (43%), Positives = 30/46 (65%) Frame = +3 Query: 510 RSQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 ++Q+G+GKT + + + I+ Q +R P ALVL+PTRELA Q Sbjct: 40 QAQSGTGKTATFSISVLQAIDTQ--LRE---PQALVLSPTRELANQ 80 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 34.3 bits (75), Expect = 0.087 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 513 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 ++TGSGKT A+++P + G AL+L+PTRELA Q Sbjct: 325 ARTGSGKTAAFLIPMFEKLQTH---TAKVGIRALILSPTRELALQ 366 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 33.9 bits (74), Expect = 0.11 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +2 Query: 380 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 511 I FE+ + + + V GYK+PTP+Q PI ++L+A Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMA 917 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 513 SQTGSGKTLAYILPAIVHINNQPP 584 +QTGSGKT A+++P + I + P Sbjct: 919 AQTGSGKTAAFLIPILSRIYMEGP 942 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 33.9 bits (74), Expect = 0.11 Identities = 20/45 (44%), Positives = 27/45 (60%) Frame = +3 Query: 513 SQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 ++TGSGKT A+ LP + + + P AL+L PTRELA Q Sbjct: 8 AETGSGKTGAFALPILQALLDNP-----QRLFALILTPTRELAFQ 47 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 33.1 bits (72), Expect = 0.20 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +3 Query: 519 TGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 TG+GKT A++LP + + +P + LV+ PTRELA Q Sbjct: 56 TGTGKTAAFMLPILERLLYRP--TQSPAIRVLVITPTRELAIQ 96 Score = 32.7 bits (71), Expect = 0.26 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 422 QGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 511 + V +G+ PTPIQA P+A+ GK++ A Sbjct: 23 RAVNELGFLHPTPIQASTIPVALMGKDVCA 52 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 33.1 bits (72), Expect = 0.20 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +3 Query: 510 RSQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 R++ G+GKT AY++P + + + ALVL PTRELA Q Sbjct: 90 RAKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQ 130 Score = 32.3 bits (70), Expect = 0.35 Identities = 12/41 (29%), Positives = 26/41 (63%) Frame = +2 Query: 389 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 511 FE+ + G+ G+ +P+PIQ + P+A++G++++A Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILA 89 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 33.1 bits (72), Expect = 0.20 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +3 Query: 510 RSQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 R++ G+GKT AY++P + + + ALVL PTRELA Q Sbjct: 90 RAKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQ 130 Score = 32.3 bits (70), Expect = 0.35 Identities = 12/41 (29%), Positives = 26/41 (63%) Frame = +2 Query: 389 FEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 511 FE+ + G+ G+ +P+PIQ + P+A++G++++A Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESIPVALAGRDILA 89 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 32.7 bits (71), Expect = 0.26 Identities = 17/46 (36%), Positives = 28/46 (60%) Frame = +3 Query: 510 RSQTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 647 +SQ+G+GKT A++L + ++ P P + L+PT ELA+Q Sbjct: 148 QSQSGTGKTAAFVLTMLSRVDATKPY-----PQVICLSPTYELARQ 188 Score = 31.1 bits (67), Expect = 0.81 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = +2 Query: 338 KHEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMS 493 KHEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ ++ Sbjct: 85 KHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLA 139 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.1 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +2 Query: 365 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 478 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +2 Query: 311 PYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 442 P+E + + KH++ V+ VE + +Q +E F + ++Q VK G Sbjct: 252 PFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQ-VKDTG 294 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 195 HQSLQILQIYCHRCQTETNYRRICCLLQIWNHRFHGY 85 H L YC RC T CCLLQ++++ ++G+ Sbjct: 484 HLQQPSLAAYC-RCITILTTAIACCLLQVYHNTYNGH 519 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 323 EEYRNK-HEVTVSGVEVHNPIQYFEEANFPDY 415 EE NK H++ + + +HNP YFE+ + DY Sbjct: 234 EEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = +3 Query: 522 GSGKTLAYILPAIVHINNQPPIRR---GDGPIALVL 620 GSGK LAY+LP I I + +GP+ L+L Sbjct: 234 GSGKRLAYLLPIIHQITESSVYQELPLANGPLVLIL 269 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 219 ALQRILFSHQSLQILQIYCHRCQTETNYRRICCLLQIWN-HRFHGYYSS 76 AL+RI + ++ C +YRR CC L +W H + Y+SS Sbjct: 197 ALERIATPVTTSKLRCSTTQECCVRVDYRRKCC-LHVWRVHTTNTYWSS 244 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,236,833 Number of Sequences: 59808 Number of extensions: 406869 Number of successful extensions: 1114 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 1029 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1101 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -