BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021246 (651 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20H4.09 |||ATP-dependent RNA helicase, spliceosomal |Schizos... 29 0.44 SPAC20H4.01 ||SPAC631.03|U3 snoRNP-associated protein Utp5|Schiz... 25 9.5 >SPAC20H4.09 |||ATP-dependent RNA helicase, spliceosomal |Schizosaccharomyces pombe|chr 1|||Manual Length = 647 Score = 29.5 bits (63), Expect = 0.44 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 546 ESCFEKLLLARIHAAWKCSILTPAPLHREL 457 E C +K+ + IHA+ C L P PLH L Sbjct: 250 EYCIKKIEDSLIHASEDCQTLVPLPLHAGL 279 >SPAC20H4.01 ||SPAC631.03|U3 snoRNP-associated protein Utp5|Schizosaccharomyces pombe|chr 1|||Manual Length = 666 Score = 25.0 bits (52), Expect = 9.5 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -1 Query: 339 ENPLSLTRHKFNATAKLYANLL 274 EN + +T FN TAKLYAN++ Sbjct: 16 ENGIGITA--FNETAKLYANVV 35 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,305,408 Number of Sequences: 5004 Number of extensions: 40322 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -