BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021245 (685 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0137 + 988442-988641,989088-989281,989369-989488,989594-98... 30 1.5 09_02_0563 - 10693152-10693589,10693789-10693951,10694090-10694337 28 7.9 06_03_0668 + 23301578-23301791,23302102-23302199,23302233-233023... 28 7.9 >02_01_0137 + 988442-988641,989088-989281,989369-989488,989594-989673, 990244-990510,990840-992458,992571-993327,993560-995506 Length = 1727 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/36 (38%), Positives = 24/36 (66%), Gaps = 2/36 (5%) Frame = -3 Query: 605 RRITS-RFQFC-NLVYQWK*NYNKKISCRHINPSKC 504 + ITS R + C NL+Y W +++ I+ +H++ SKC Sbjct: 1204 KSITSMRLENCPNLIYNWSEAFSQLIALKHLDISKC 1239 >09_02_0563 - 10693152-10693589,10693789-10693951,10694090-10694337 Length = 282 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 6/36 (16%) Frame = +1 Query: 592 DVILRNTMY------DINVLTK*MSTLKKKGFLSCI 681 D+I+RN +Y D+ ++ T +KKGF SC+ Sbjct: 136 DIIIRNAVYGCRRSVDVGFISSVHKTTRKKGFSSCL 171 >06_03_0668 + 23301578-23301791,23302102-23302199,23302233-23302301, 23302674-23302961,23303045-23303208,23303344-23303599, 23303706-23303816,23304109-23304195,23305916-23305985, 23306093-23306149,23306309-23306426,23307314-23307403, 23307492-23307671,23307816-23307893,23308016-23308088 Length = 650 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/61 (27%), Positives = 32/61 (52%) Frame = +1 Query: 214 LLFKCFVIIVE*KSLC*KSIDCDNIMFVFLNCIVIWVLDKSMQVQNLKENGLVILKHITF 393 +L KC V++ S+ + I DNI+ V + +DKS+ + L + V L++ ++ Sbjct: 101 VLVKCCVLVFVHMSVALEIIGEDNILLVHPEGKYVVDVDKSIDITKLSPSTRVALRNDSY 160 Query: 394 M 396 M Sbjct: 161 M 161 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,967,318 Number of Sequences: 37544 Number of extensions: 271491 Number of successful extensions: 463 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -