BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021243 (555 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 53 2e-09 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 1.6 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 1.6 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 1.6 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 1.6 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 6.3 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 6.3 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 6.3 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 8.4 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 53.2 bits (122), Expect = 2e-09 Identities = 24/55 (43%), Positives = 34/55 (61%) Frame = +1 Query: 343 NNHEVTVSGVDVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGK 507 +N +V VSG +V PI+ FE A + V +K GYK+PTP+Q PI M+G+ Sbjct: 180 DNIQVNVSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGR 234 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 462 DAYSSSRLADSYVWKDLVGVLKRVPA 539 ++ S + A +YVWK+ G L++ P+ Sbjct: 205 ESISYEQTAITYVWKNDEGTLRKSPS 230 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 462 DAYSSSRLADSYVWKDLVGVLKRVPA 539 ++ S + A +YVWK+ G L++ P+ Sbjct: 205 ESISYEQTAITYVWKNDEGTLRKSPS 230 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 462 DAYSSSRLADSYVWKDLVGVLKRVPA 539 ++ S + A +YVWK+ G L++ P+ Sbjct: 256 ESISYEQTAITYVWKNDEGTLRKSPS 281 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +3 Query: 462 DAYSSSRLADSYVWKDLVGVLKRVPA 539 ++ S + A +YVWK+ G L++ P+ Sbjct: 205 ESISYEQTAITYVWKNDEGTLRKSPS 230 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 6.3 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = -3 Query: 250 PIWATHVLTSREFFFP 203 P+W H+ R FP Sbjct: 634 PVWGRHIYDGRAMGFP 649 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 6.3 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 84 TGIIAVETVVPNLEEATNSA 143 T + A V P +EE TN+A Sbjct: 412 TALGAAALVAPGMEEPTNTA 431 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 6.3 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = -3 Query: 250 PIWATHVLTSREFFFP 203 P+W H+ R FP Sbjct: 634 PVWGRHIYDGRAMGFP 649 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 554 DVANVCRNPFEYAN 513 DV + CR PF++ N Sbjct: 407 DVRDGCRTPFQWDN 420 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,063 Number of Sequences: 438 Number of extensions: 2788 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15949830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -