BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021242 (801 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 32 0.11 SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 comple... 30 0.44 SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizos... 27 2.3 SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk... 26 7.2 SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces ... 25 9.5 SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual 25 9.5 SPAC24C9.11 |||MIF4G/MA4 domain protein|Schizosaccharomyces pomb... 25 9.5 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 31.9 bits (69), Expect = 0.11 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +2 Query: 227 ASEVVNFDELDNFCRSHGQVPATHLSNVCLINFRW*F---LRLPWLSRVTGNQGSIPERE 397 + E+++F E G + L C+IN W LRL +L + NQ S E++ Sbjct: 243 SKEIIDFLEKSKTLVELGMDSSCSLVAECMINETWPVDRALRLQFLIQQRNNQSSNEEQK 302 Query: 398 PEKRLP 415 EKR+P Sbjct: 303 QEKRVP 308 >SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 442 Score = 29.9 bits (64), Expect = 0.44 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 287 VLDHAICKSYPIHQN*RLRTRGPPSIGFDLIKALIP 180 ++D K Y IH + L + PS GF +I++L+P Sbjct: 391 LIDQGYIKGYIIHASSTLVLKKDPSFGFSVIESLMP 426 >SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 607 Score = 27.5 bits (58), Expect = 2.3 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 Query: 436 RANYPLPAREVVTKNNDT 489 +AN P+P EVVT+NN T Sbjct: 199 KANIPVPTSEVVTENNVT 216 >SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 25.8 bits (54), Expect = 7.2 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 424 PWMW*PFLRLPLRNRTLIPRYP*QPW*SQKLPS 326 P MW P N+ + YP +PW S+ LPS Sbjct: 236 PSMWPELSTFPDWNKFIFHEYPPKPW-SEILPS 267 >SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 25.4 bits (53), Expect = 9.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 422 LDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 321 L ++ S+ P + PD P T+ V+ TT+E+ Sbjct: 422 LGLINTSEINQPANLPDEPTAETSNPVSATTVEA 455 >SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual Length = 478 Score = 25.4 bits (53), Expect = 9.5 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -1 Query: 471 HYLPCREWVICAPA 430 HY+PC+ W++ P+ Sbjct: 455 HYIPCQSWLVWYPS 468 >SPAC24C9.11 |||MIF4G/MA4 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 25.4 bits (53), Expect = 9.5 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Frame = +2 Query: 338 LRLPW--LSRVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRHGR**RKITIRDSYEASN 511 L+LP L + + S + LPH K A+I+ ++G RKIT ++S Sbjct: 10 LKLPKSILEEIGESDSSARRGKRNHNLPHREKRKFARISRGKNGYENRKITEEGDSKSSE 69 Query: 512 RNE 520 N+ Sbjct: 70 LND 72 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,179,395 Number of Sequences: 5004 Number of extensions: 63765 Number of successful extensions: 127 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 388424860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -