BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021242 (801 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0861 + 8153108-8153266,8154633-8155136 29 3.3 06_02_0092 - 11624905-11625123,11625206-11625292,11625767-116258... 28 9.9 04_03_0946 + 20975955-20976095,20976189-20976330,20976449-209765... 28 9.9 03_04_0201 - 18409088-18409306,18409389-18409475,18409950-184100... 28 9.9 01_05_0005 - 16886553-16886946,16887079-16887404 28 9.9 >12_01_0861 + 8153108-8153266,8154633-8155136 Length = 220 Score = 29.5 bits (63), Expect = 3.3 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = -2 Query: 509 SRPRKSPVSLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNP--DSPLPVTTMVVAE 336 S+ R +P SL + G RL S +VA+ + P P S+P D P TT+ + E Sbjct: 88 SQLRAAPRSLLSSPSPHCQEGHDPRLCVSAGLVAIPRCPPPTSSPSLDPPESSTTVALIE 147 >06_02_0092 - 11624905-11625123,11625206-11625292,11625767-11625889, 11625992-11626351,11626427-11626511,11626603-11626661, 11627173-11627265,11627360-11627464,11627539-11627636, 11627811-11627916,11628009-11628131,11628986-11629021, 11629113-11629310,11629415-11629612,11629917-11630056, 11630181-11630322,11630416-11630556 Length = 770 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = -2 Query: 485 SLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTM 348 ++ F T S +GS F+R+ + DVV + +A +P LP T + Sbjct: 428 AIVFSTLSFSGSSIFSRMARAFDVVIIDEAAQAVGDP-VQLPATVI 472 >04_03_0946 + 20975955-20976095,20976189-20976330,20976449-20976588, 20976893-20977090,20977195-20977392,20977484-20977519, 20978374-20978496,20978589-20978694,20978869-20978966, 20979041-20979145,20979240-20979332,20979842-20979900, 20979984-20980068,20980144-20980503,20980606-20980728, 20981203-20981289,20981372-20981590 Length = 770 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = -2 Query: 485 SLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTM 348 ++ F T S +GS F+R+ + DVV + +A +P LP T + Sbjct: 428 AIVFSTLSFSGSSIFSRMARAFDVVIIDEAAQAVGDP-VQLPATVI 472 >03_04_0201 - 18409088-18409306,18409389-18409475,18409950-18410072, 18410175-18410534,18410610-18410694,18410780-18410838, 18411350-18411442,18411537-18411641,18411716-18411813, 18411988-18412093,18412186-18412308,18413163-18413198, 18413290-18413487,18413592-18413789,18414094-18414233, 18414356-18414497,18414591-18414731 Length = 770 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = -2 Query: 485 SLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTM 348 ++ F T S +GS F+R+ + DVV + +A +P LP T + Sbjct: 428 AIVFSTLSFSGSSIFSRMARAFDVVIIDEAAQAVGDP-VQLPATVI 472 >01_05_0005 - 16886553-16886946,16887079-16887404 Length = 239 Score = 27.9 bits (59), Expect = 9.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 619 RNNFSIRYWSWNYRGC 572 R+N S RYW W GC Sbjct: 90 RSNSSFRYWRWQPHGC 105 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,618,058 Number of Sequences: 37544 Number of extensions: 463237 Number of successful extensions: 1200 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1200 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2174172540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -