BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021242 (801 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.067 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 32 0.62 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 32 0.62 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_12062| Best HMM Match : NUC129 (HMM E-Value=9.2) 30 2.5 SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) 29 5.8 SB_24390| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -2 Query: 419 DVVAVSQAPSPESNPDSPLPVTTM 348 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 410 AVSQAPSPESNPDSPLPVTTM 348 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 2 PVVICLSQRLSHACLSASRIKAIPRMA 82 PVVICLSQRLSHACLS S RMA Sbjct: 135 PVVICLSQRLSHACLSISTCTVKLRMA 161 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +2 Query: 500 EASNRNEYTLNILTRNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 667 + + R ++++ R +WRASL Y K+VAVKKLVV F VG P Sbjct: 47 QTTTRVHAAMHLVIRIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 102 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +2 Query: 2 PVVICLSQRLSHACLSASRIKAIPRMA 82 PVVICLSQRLSHACLS S RMA Sbjct: 111 PVVICLSQRLSHACLSISTRTVKLRMA 137 >SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/42 (47%), Positives = 22/42 (52%) Frame = +2 Query: 542 RNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 667 R +WRASL Y K+VAVKKLVV F VG P Sbjct: 14 RIHWRASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 55 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.067 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 409 PFLRLPLRNRTLIPRYP 359 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 31.9 bits (69), Expect = 0.62 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 447 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 491 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 31.9 bits (69), Expect = 0.62 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 9 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 143 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 866 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 910 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 0.82 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +2 Query: 554 RASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 667 RASL Y K+VAVKKLVV F VG P Sbjct: 5 RASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 42 >SB_12062| Best HMM Match : NUC129 (HMM E-Value=9.2) Length = 111 Score = 29.9 bits (64), Expect = 2.5 Identities = 29/92 (31%), Positives = 41/92 (44%), Gaps = 3/92 (3%) Frame = +2 Query: 401 EKRLPHPRKAA---GAQITHSRHGR**RKITIRDSYEASNRNEYTLNILTRNNWRASLXX 571 E+R P + A ++ T R G+ + +RD+ AS+ L I+ R R + Sbjct: 25 ERRREEPVQGAFCRSSRFTFERRGKEKDRGRLRDN--ASSAQAILLEIVKRKVTRKATCA 82 Query: 572 XXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 667 Y K+VAVKKLVV F VG P Sbjct: 83 RCFAA-----YIKVVAVKKLVVGFRDGTVGPP 109 >SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +2 Query: 542 RNNWRASLXXXXXXXXXXXXYTKIVAVKKLVVAFVRRAVGAP 667 R ASL Y K+VAVKKLVV F VG P Sbjct: 24 RERRAASLVPAAAVIPAPIAYIKVVAVKKLVVGFRDGTVGPP 65 >SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +2 Query: 602 YTKIVAVKKLVVAFVRRAVGAP 667 Y K+VAVKKLVV F VG P Sbjct: 89 YIKVVAVKKLVVGFRDGTVGPP 110 >SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +2 Query: 602 YTKIVAVKKLVVAFVRRAVGAP 667 Y K+VAVKKLVV F VG P Sbjct: 17 YIKVVAVKKLVVGFRDGTVGPP 38 >SB_34251| Best HMM Match : FA_hydroxylase (HMM E-Value=5.5) Length = 203 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -3 Query: 640 CNYELFNRNNFSIRYWSWNYRGCWH 566 C + RN +RYW W R C H Sbjct: 91 CEVTVIARNILPVRYWIWLSRKCGH 115 >SB_24390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -3 Query: 703 ICSANVSVSPRMRCTDSAAHKCNYELFNRNNFSIRYW-SWNY 581 I S S R+RCT S + KC + + F W S+NY Sbjct: 139 ISSGYYGRSYRLRCTSSTSWKCRLTSISESYFKGNNWFSYNY 180 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,692,448 Number of Sequences: 59808 Number of extensions: 519276 Number of successful extensions: 1430 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1285 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1430 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -