BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021240 (659 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0984 - 9985300-9985804,9985894-9986933 29 2.5 08_02_0795 + 21273453-21273752 28 7.6 01_01_0878 + 6888459-6889227,6890498-6890523,6891679-6891843,689... 28 7.6 >12_01_0984 - 9985300-9985804,9985894-9986933 Length = 514 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Frame = +2 Query: 335 RALKLLTPHTPVKITIEVL-HSVAVYEEALAALSAAFGRHSLHVATAQEDLAYAHYVLET 511 R KL + H + ++++ H + YEEAL + G+HSL Y+++ Sbjct: 279 RLTKLRSLHIGLHSSLKLCYHDMRTYEEALKSSLTVLGKHSLRSLVISRADCLGDYLMDL 338 Query: 512 LRD 520 L D Sbjct: 339 LCD 341 >08_02_0795 + 21273453-21273752 Length = 99 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 Query: 367 GRVRSEELERPHAPRVGGSVVAADEEQRAE 278 GRVR E R HA R+GG V E AE Sbjct: 6 GRVRYGECRRNHAARMGGHAVDGCREFLAE 35 >01_01_0878 + 6888459-6889227,6890498-6890523,6891679-6891843, 6892415-6892494,6893001-6893154,6893808-6893864, 6894103-6894170,6894238-6894344,6894475-6894542, 6894885-6895007 Length = 538 Score = 27.9 bits (59), Expect = 7.6 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 3/49 (6%) Frame = -2 Query: 169 SPSVCEAT--SQVSATLNE-HSGSSATSSVMPNSFKASEYVSAAAGKQQ 32 S S CEA+ S S+ N SG+++TSS+ S AS S+AAG ++ Sbjct: 64 SSSSCEASTCSSSSSAFNPGSSGAASTSSLSAFSSSASTASSSAAGDER 112 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,070,288 Number of Sequences: 37544 Number of extensions: 279806 Number of successful extensions: 1112 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1076 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1112 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -