BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021236 (839 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizos... 27 4.4 SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharom... 26 7.6 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 26 7.6 SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe... 26 7.6 SPAC3C7.01c ||SPAC732.03c|inositol polyphosphate phosphatase |Sc... 26 7.6 >SPCC1450.11c |cek1||serine/threonine protein kinase Cek1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1338 Score = 26.6 bits (56), Expect = 4.4 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 795 GNISCGPADPNPLIHTTRPNRARLHPT 715 G++ P+P IHT PN A HP+ Sbjct: 559 GDVGLRLPSPSPRIHTIVPNSAPEHPS 585 >SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharomyces pombe|chr 2|||Manual Length = 1016 Score = 25.8 bits (54), Expect = 7.6 Identities = 21/76 (27%), Positives = 31/76 (40%) Frame = +1 Query: 247 KLMQANY*TMKSSRRQSHKFNS*KISTRKEKKNDLKS*EYVTQRHLANASVTVS*KVYRF 426 K+ +A KSS + H K S+ K K+ND S T S+T + V Sbjct: 541 KIYKAQQHKQKSSHHKHHHHKKSKSSSSKHKENDKASVSITT---TTTPSITPADPVPTS 597 Query: 427 KKKMKLNLFKRSMIFA 474 K + + KR + A Sbjct: 598 PKPLAIEPVKRKPVHA 613 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 25.8 bits (54), Expect = 7.6 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +2 Query: 662 ESR*SPSSSLGVVWYSGAVGCSLALFGRVVCISGLGSAGPHEMFPQTSP-SW 814 ESR P + V+W +G GCS +L G + + G S + P+ +P SW Sbjct: 607 ESRNDPENDPVVLWLNGGPGCS-SLTGLFMEL-GPSSINIETLKPEYNPHSW 656 >SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe|chr 2|||Manual Length = 721 Score = 25.8 bits (54), Expect = 7.6 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +1 Query: 232 AGTKEKLMQANY*TMKSSRRQSHKFNS*KISTRKEKK---NDLKS 357 A E+L N+ T + +R++HK KIS K K ND KS Sbjct: 431 AEADERLRLENFSTWVNEKRETHKILLEKISKNKRLKFELNDRKS 475 >SPAC3C7.01c ||SPAC732.03c|inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 611 Score = 25.8 bits (54), Expect = 7.6 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -1 Query: 461 DLLNRLSFIFFLNRYTFHETV 399 +L ++ ++ FF N+Y FHE + Sbjct: 148 ELTSKYNYRFFWNKYAFHELI 168 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,158,022 Number of Sequences: 5004 Number of extensions: 61496 Number of successful extensions: 156 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 414453330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -