BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021235 (816 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 60 2e-09 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 43 3e-04 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 42 5e-04 SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) 41 0.001 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 40 0.002 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 40 0.002 SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) 37 0.017 SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 35 0.069 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 35 0.091 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.21 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 33 0.28 SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) 32 0.48 SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) 31 0.84 SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) 31 1.5 SB_13046| Best HMM Match : La (HMM E-Value=5e-23) 31 1.5 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 30 2.0 SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) 30 2.0 SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 30 2.6 SB_44751| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 29 4.5 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 29 4.5 SB_3721| Best HMM Match : RRM_1 (HMM E-Value=3.1) 29 4.5 SB_57638| Best HMM Match : F5_F8_type_C (HMM E-Value=1.7e-11) 29 6.0 SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 60.5 bits (140), Expect = 2e-09 Identities = 28/52 (53%), Positives = 39/52 (75%) Frame = +3 Query: 249 QSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLIK 404 + FG V+ R+ RS+++ RSKGYAFVEF VA+I A+TM+NY+M RL+K Sbjct: 119 EQFGTVNRIRLSRSKKSARSKGYAFVEFACDEVAKIAADTMHNYMMFGRLLK 170 Score = 39.1 bits (87), Expect = 0.004 Identities = 12/21 (57%), Positives = 20/21 (95%) Frame = +1 Query: 187 GLVYLGHIPHGFYEHQMTQYF 249 G++YLGHIPHGF+E+++ ++F Sbjct: 98 GVIYLGHIPHGFFENEIKKFF 118 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/60 (35%), Positives = 34/60 (56%) Frame = +3 Query: 243 ILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLIKAAYIPP 422 I + G V++C++IR R TG+S GYAFV + +P A MN + + +K ++ P Sbjct: 46 IFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARP 105 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/80 (26%), Positives = 45/80 (56%), Gaps = 3/80 (3%) Frame = +3 Query: 243 ILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLIKAAYIPP 422 + ++ ++NC+++R + +G S G+ FV+++ AQ + +N + +G +++K A+ P Sbjct: 66 MFEAVASLNNCKIVRHKPSGWSYGFGFVDYNTTEDAQKAIDKLNGFTIGNKVLKVAFSRP 125 Query: 423 --DKRRWAMRYTWN-PQNNP 473 D + A Y N P+ P Sbjct: 126 GGDNTKGANLYVCNIPKQLP 145 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/54 (35%), Positives = 30/54 (55%) Frame = +3 Query: 243 ILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLIK 404 + + FG V + ++I T RSKGY FV+F + A+ E MN + + R +K Sbjct: 261 VFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLK 314 Score = 35.1 bits (77), Expect = 0.069 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +3 Query: 258 GGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMG 389 G VS+ R+I R + RSKG A++EF D + + L+G Sbjct: 170 GQVSDVRIISDRNSRRSKGIAYIEFTDKSAVPLAIGLSGQKLLG 213 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 2/80 (2%) Frame = +3 Query: 240 TILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLIKA--AY 413 ++ ++FG V +C + + TG+ KGY F+E+ + A +MN + +G + ++ A Sbjct: 217 SVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDAIASMNLFDLGGQFLRVGRAI 276 Query: 414 IPPDKRRWAMRYTWNPQNNP 473 PP A T P P Sbjct: 277 TPPTSSAMAAINTTPPGTLP 296 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = +3 Query: 240 TILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLIK 404 T FG ++ + + KG+AFVE+ P AQ+ E MN L+G R IK Sbjct: 120 TAFHPFGPINKIDLSWDPLNMKHKGFAFVEYDLPEAAQLALEQMNGVLLGGRNIK 174 >SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) Length = 209 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/55 (36%), Positives = 29/55 (52%) Frame = +3 Query: 237 DTILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLI 401 + I FG + +C VIR ++TG S YAF+EF + M+N L+ R I Sbjct: 137 EIIFSRFGTILSCEVIRDQKTGESLQYAFIEFEKDEDCERAYFKMDNVLIDDRRI 191 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +3 Query: 243 ILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMG-KRLI 401 +L SFG + +++ TG SKGYAF E+ D + + + +N +G K+LI Sbjct: 692 LLSSFGELRAFNLVKDSATGLSKGYAFCEYVDLGITDVAIQGLNGMQLGDKKLI 745 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 3/80 (3%) Frame = +3 Query: 243 ILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLIKAAYIPP 422 I G V + R++ R TG+ KGY F E+ D A +N Y + R ++ Sbjct: 44 IFSEVGPVISFRLVFDRETGKPKGYGFCEYKDQETALSAMRNLNGYELNGRALRVDSAAS 103 Query: 423 DKRR---WAMRYTWNPQNNP 473 +K + +M T P+ +P Sbjct: 104 EKNKEEIKSMEMTARPEVSP 123 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/64 (29%), Positives = 34/64 (53%) Frame = +3 Query: 231 SNDTILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLIKAA 410 + D++ +F G SN +VI R +G S+G+ FV++ D A+ V M + R ++ Sbjct: 301 TTDSLGAAFEGCSNAKVIFDRESGESRGFGFVDYDDVETAKKVLSEMAGAEVDGRQVRLD 360 Query: 411 YIPP 422 + P Sbjct: 361 FASP 364 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/51 (33%), Positives = 28/51 (54%) Frame = +3 Query: 249 QSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLI 401 + FG + C V+R T RS+G+ F+ F DP +V + L GK+++ Sbjct: 129 EKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKMV 179 >SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 781 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = +3 Query: 249 QSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYL 383 +SFG + +++R +T +KGY +V+FH + A + E + L Sbjct: 74 ESFGDIEYVQIVRDHKTRENKGYGYVKFHKSSTAAMALENCDKSL 118 >SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 1026 Score = 37.1 bits (82), Expect = 0.017 Identities = 26/93 (27%), Positives = 43/93 (46%), Gaps = 5/93 (5%) Frame = +3 Query: 243 ILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHD-PAVAQIVAETMNN----YLMGKRLIKA 407 + + FG ++ C+V+ T SKG AFV++ +V Q +A T + +L G RL Sbjct: 435 LFKQFGDIAYCKVVVDHLTQHSKGSAFVKYRSAESVTQCLAATDEDSEGLFLDGNRLQVD 494 Query: 408 AYIPPDKRRWAMRYTWNPQNNPVLNTNLKLKKQ 506 + P K R + +P NL L ++ Sbjct: 495 LAVTPGKLEQMSRQQKEERRDPKDKRNLYLARE 527 >SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 37.1 bits (82), Expect = 0.017 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 4/84 (4%) Frame = +3 Query: 243 ILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNN-YLMGKRL-IKAAYI 416 + +G + N V RRTG KGYA VE+ AQ E +N ++G+ + + A+I Sbjct: 312 LFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEALNGAEMLGQNISVDWAFI 371 Query: 417 --PPDKRRWAMRYTWNPQNNPVLN 482 P K R T P + + N Sbjct: 372 RGPSKKSRSLQAVTSLPLSKRIAN 395 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 36.7 bits (81), Expect = 0.022 Identities = 13/50 (26%), Positives = 27/50 (54%) Frame = +3 Query: 255 FGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLIK 404 +G + N ++R ++TG+ KG+ F+ + D + + N +G R I+ Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRSTILAVDNFNGIKLGGRTIR 51 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 35.1 bits (77), Expect = 0.069 Identities = 23/72 (31%), Positives = 34/72 (47%) Frame = +3 Query: 162 NKKKETCKRACLFGTYPTWIL*ASNDTILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDP 341 N K +R+ G P I + + G V + R+IR R+TG KG+ +V F + Sbjct: 48 NDKAHDHQRSVFIGNLPFDIEEEPLRELFTTCGNVESVRLIRDRKTGIGKGFGYVLF-ES 106 Query: 342 AVAQIVAETMNN 377 A + A MNN Sbjct: 107 KDAVVFALKMNN 118 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 34.7 bits (76), Expect = 0.091 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 4/129 (3%) Frame = +3 Query: 99 KEEKNASEGSDPRHP*STRRENKKKETCKRACLFGTYPTWIL*ASN-DTILQSFGGVSNC 275 ++ K +S S R + R K+ T K L+ + T + + I +G V Sbjct: 1127 RKGKRSSSSSSSRSRSRSPRRRKRSPTPKPTKLYVAHLTRNVNKDHVQEIFSVYGRVKTV 1186 Query: 276 RVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMN-NYLMGKRLIKAAYIPPDKR--RWAMR 446 + R S+G+A+VE+ DP + + M+ + G+ + + +PP R R A R Sbjct: 1187 DLPTDRTNNLSRGFAYVEYVDPEECEKALKHMDGGQIDGQEIAVQSVLPPRPRDVRPAYR 1246 Query: 447 YTWNPQNNP 473 P+ P Sbjct: 1247 RPSPPRRRP 1255 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 4/61 (6%) Frame = +3 Query: 243 ILQSFGGVSNCRVIRSRRTGRSKGYAFVEF----HDPAVAQIVAETMNNYLMGKRLIKAA 410 ++ +G + ++RS TG SKGY FVE+ + Q + T + Y+ G R+++ A Sbjct: 132 LMSPYGNIERLFLVRSEVTGDSKGYGFVEYATRENAMQAKQQLLNTASKYI-GGRILRVA 190 Query: 411 Y 413 + Sbjct: 191 F 191 >SB_39475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 34.3 bits (75), Expect = 0.12 Identities = 21/79 (26%), Positives = 33/79 (41%) Frame = +3 Query: 237 DTILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLIKAAYI 416 + + G V R++ + R G+ KGY +VE+ + A T++ + R I A Sbjct: 188 EELFSKHGVVKQVRLV-TNRAGKPKGYGYVEYEQESSASTAVLTLDKTEVKGRTISVALS 246 Query: 417 PPDKRRWAMRYTWNPQNNP 473 P RR R P P Sbjct: 247 NPPTRRGPPRQEHPPPPPP 265 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +3 Query: 276 RVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLIKAAY 413 +++R TG SKG+AF+ F + E MN + R I +Y Sbjct: 131 KIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSY 176 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/74 (27%), Positives = 31/74 (41%) Frame = +3 Query: 183 KRACLFGTYPTWIL*ASNDTILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVA 362 K G P + + + + +G V ++R + T S+G AF+ F D AQ Sbjct: 9 KSTVYVGNLPYSLTNSDLHKVFERYGKVVKVTILRDKETRESRGVAFILFIDRQSAQNAV 68 Query: 363 ETMNNYLMGKRLIK 404 +N M R IK Sbjct: 69 AAVNKKQMFGRTIK 82 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 33.1 bits (72), Expect = 0.28 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 4/70 (5%) Frame = +3 Query: 255 FGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRL-IKAAYI---PP 422 FG + VI+ R T +SKGY FV A++ + + G++ + AY+ P Sbjct: 33 FGEIREAVVIKDRVTKKSKGYGFVTMATSDAAELACKNKRPMIEGRQANVNLAYLGAKPK 92 Query: 423 DKRRWAMRYT 452 R MR T Sbjct: 93 PTRGLCMRLT 102 >SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) Length = 672 Score = 32.3 bits (70), Expect = 0.48 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +3 Query: 276 RVIRSRRTGRSKGYAFVEFHDP 341 +++R +++ +SKGY FV F DP Sbjct: 247 KIVRDKKSNKSKGYGFVSFKDP 268 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 31.9 bits (69), Expect = 0.64 Identities = 14/54 (25%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +3 Query: 243 ILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMN-NYLMGKRLI 401 + + +G + + + R R T S+G+AFV F++ A+ + M+ LM ++ + Sbjct: 35 VFKKYGDLGDIYIPRDRNTHESRGFAFVRFYEKRDAEDAMDCMDATCLMAEKFV 88 >SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) Length = 44 Score = 31.5 bits (68), Expect = 0.84 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = +3 Query: 255 FGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMN 374 +G + N ++R ++TG+ KG+ F+ + D + + N Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRSTILAVDNFN 41 >SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +3 Query: 258 GGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLI 401 G + N R+ + TG+ + + FVEF P +E ++ + R I Sbjct: 481 GPLENVRIPTDKNTGQQRSFGFVEFSSPVSVHYASELLDGIRLYDRAI 528 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +3 Query: 261 GVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLIKAA 410 GV ++R + +GRS+G+ FV E MN +G R I A Sbjct: 33 GVEKVDILRDKESGRSRGFGFVLLQSADQIAPAIEKMNQSSVGGRNITVA 82 >SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) Length = 145 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/62 (25%), Positives = 34/62 (54%) Frame = +3 Query: 168 KKETCKRACLFGTYPTWIL*ASNDTILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAV 347 K+E +R + I +S +++ +G + + +IR++ TG+SKG+ +V + + Sbjct: 57 KEEHDQRTIYIRDFRPDIRKSSLESVFGPYGAIEDLSIIRTQ-TGKSKGFGYVTYENAES 115 Query: 348 AQ 353 AQ Sbjct: 116 AQ 117 >SB_13046| Best HMM Match : La (HMM E-Value=5e-23) Length = 442 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +3 Query: 243 ILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETMN 374 + FG V + R + G KG+AF+EF A+ V + N Sbjct: 107 VFSEFGKVLYVSLPRFKHNGEIKGFAFIEFESKQQAEHVVQMFN 150 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/82 (26%), Positives = 42/82 (51%), Gaps = 1/82 (1%) Frame = +3 Query: 255 FGGVSNCRVIRSRRTGRSKGYAFVEFHDP-AVAQIVAETMNNYLMGKRLIKAAYIPPDKR 431 +G V+ ++ R TG+SKG V+ P V +I+ E + +++GK ++ +R Sbjct: 342 YGQVAKVHILTDRETGKSKGCGVVKLRHPGTVNKILEEPV--HVIGKSQVRLR-----RR 394 Query: 432 RWAMRYTWNPQNNPVLNTNLKL 497 +R T N + ++N +L L Sbjct: 395 GLKIRPTRNTDDLSLMNFSLSL 416 >SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) Length = 419 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 243 ILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQ-IVAETMN 374 + +G + + + I + T KGY FV+F P AQ VA +N Sbjct: 119 LCHKYGTIISTKAILDKDTNLCKGYGFVDFESPISAQKAVAALVN 163 >SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1182 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 237 DTILQSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVAQIVAETM 371 +T +FG V++ R++ RRTG +KG A + D + V + + Sbjct: 1083 ETFFSNFGPVADVRIVCDRRTGLNKGDAQPKCRDELAKRTVLKNV 1127 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 249 QSFGGVSNCRVIRSRRTGRSKGYAFVEFHDPAVA 350 + +G V +++R + G SKGYAF+ F VA Sbjct: 29 EEYGVVKESKIVRDKH-GVSKGYAFITFESQEVA 61 >SB_44751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 842 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 477 RQDCSEGSMCISWPIFVYQVVCKQLLSIFS 388 R+DC GS C P + V CK LLS ++ Sbjct: 595 RRDCPAGSFCHIHPTDRFAVCCKDLLSSYT 624 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 29.5 bits (63), Expect = 3.4 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 291 RRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLIKAAYIP 419 RR KG+ FV F DPA + V + L GK + +P Sbjct: 136 RRARMLKGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVP 178 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 29.1 bits (62), Expect = 4.5 Identities = 24/96 (25%), Positives = 38/96 (39%), Gaps = 1/96 (1%) Frame = +3 Query: 108 KNASEGSDPRHP*STRRENKKKETCKRACLFGTYPTWIL*ASNDTILQSFGGVSNCRV-I 284 KN SD P T + +K K T C P A + IL+ F + + Sbjct: 142 KNPDGSSDVDEPQETPQPDKPKPTTPWTCKMRGLP---FKAKDKHILEFFSPLKPVAIRF 198 Query: 285 RSRRTGRSKGYAFVEFHDPAVAQIVAETMNNYLMGK 392 + G+ G AFV+F + + + +YL G+ Sbjct: 199 VMNKKGQPSGCAFVDFSSKSDLEKALKRNKDYLQGR 234 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 300 GRSKGYAFVEFHDPAVAQIVAETMNNYLMGKRLIKA 407 G+SKG+ FV F P A+ +N +G R + A Sbjct: 146 GKSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRLWA 181 >SB_3721| Best HMM Match : RRM_1 (HMM E-Value=3.1) Length = 51 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +3 Query: 300 GRSKGYAFVEFHDPAVAQ 353 GRSKGYA+VEF++ + Q Sbjct: 3 GRSKGYAYVEFNNESTVQ 20 >SB_57638| Best HMM Match : F5_F8_type_C (HMM E-Value=1.7e-11) Length = 502 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -1 Query: 447 ISWPIFVYQVVCKQLLSIFSP*DNYSWSQQQFVRQQDHETL 325 + W +FV + LS+FS WS + F R ++ + L Sbjct: 1 MKWWVFVICTITTNFLSVFSKTHEVEWSTEFFQRSKNEKVL 41 >SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 96 YKEEKNASEGSDPR-HP*STRRENKKKETCKRA 191 Y+EE++ASEG + HP R+ +K+ T A Sbjct: 110 YEEEESASEGQEANPHPPRGRKRKRKRPTASTA 142 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,822,389 Number of Sequences: 59808 Number of extensions: 322788 Number of successful extensions: 631 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 631 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2275631710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -