BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021233 (796 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC119683-1|AAI19684.1| 449|Homo sapiens required for meiotic nu... 54 4e-07 BC106065-1|AAI06066.1| 449|Homo sapiens required for meiotic nu... 54 4e-07 AL590543-1|CAI10940.1| 449|Homo sapiens required for meiotic nu... 54 4e-07 AL590413-8|CAI13595.1| 211|Homo sapiens required for meiotic nu... 54 4e-07 AL590413-7|CAI13594.1| 238|Homo sapiens required for meiotic nu... 54 4e-07 AL590413-1|CAI13588.1| 449|Homo sapiens required for meiotic nu... 54 4e-07 AK000634-1|BAA91299.1| 449|Homo sapiens protein ( Homo sapiens ... 54 4e-07 >BC119683-1|AAI19684.1| 449|Homo sapiens required for meiotic nuclear division 1 homolog (S. cerevisiae) protein. Length = 449 Score = 54.4 bits (125), Expect = 4e-07 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = +2 Query: 521 IFFFKEGAVVFWNCSELEASNVLEFVKPYELESYPREVIEKEREIMTYIYQPNSKKCHLQ 700 IFFF+EGA VFWN + +V++ ++ +E++ Y ++ E E + YI K H Sbjct: 226 IFFFREGAAVFWNVKDKTMKHVMKVLEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRG 285 Query: 701 ESCFIMVPERDNS-LERFAFS 760 E + D++ LE+FAFS Sbjct: 286 EIKLNSELDLDDAILEKFAFS 306 >BC106065-1|AAI06066.1| 449|Homo sapiens required for meiotic nuclear division 1 homolog (S. cerevisiae) protein. Length = 449 Score = 54.4 bits (125), Expect = 4e-07 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = +2 Query: 521 IFFFKEGAVVFWNCSELEASNVLEFVKPYELESYPREVIEKEREIMTYIYQPNSKKCHLQ 700 IFFF+EGA VFWN + +V++ ++ +E++ Y ++ E E + YI K H Sbjct: 226 IFFFREGAAVFWNVKDKTMKHVMKVLEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRG 285 Query: 701 ESCFIMVPERDNS-LERFAFS 760 E + D++ LE+FAFS Sbjct: 286 EIKLNSELDLDDAILEKFAFS 306 >AL590543-1|CAI10940.1| 449|Homo sapiens required for meiotic nuclear division 1 homolog (S. cerevisiae) protein. Length = 449 Score = 54.4 bits (125), Expect = 4e-07 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = +2 Query: 521 IFFFKEGAVVFWNCSELEASNVLEFVKPYELESYPREVIEKEREIMTYIYQPNSKKCHLQ 700 IFFF+EGA VFWN + +V++ ++ +E++ Y ++ E E + YI K H Sbjct: 226 IFFFREGAAVFWNVKDKTMKHVMKVLEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRG 285 Query: 701 ESCFIMVPERDNS-LERFAFS 760 E + D++ LE+FAFS Sbjct: 286 EIKLNSELDLDDAILEKFAFS 306 >AL590413-8|CAI13595.1| 211|Homo sapiens required for meiotic nuclear division 1 homolog (S. cerevisiae) protein. Length = 211 Score = 54.4 bits (125), Expect = 4e-07 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = +2 Query: 521 IFFFKEGAVVFWNCSELEASNVLEFVKPYELESYPREVIEKEREIMTYIYQPNSKKCHLQ 700 IFFF+EGA VFWN + +V++ ++ +E++ Y ++ E E + YI K H Sbjct: 56 IFFFREGAAVFWNVKDKTMKHVMKVLEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRG 115 Query: 701 ESCFIMVPERDNS-LERFAFS 760 E + D++ LE+FAFS Sbjct: 116 EIKLNSELDLDDAILEKFAFS 136 >AL590413-7|CAI13594.1| 238|Homo sapiens required for meiotic nuclear division 1 homolog (S. cerevisiae) protein. Length = 238 Score = 54.4 bits (125), Expect = 4e-07 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = +2 Query: 521 IFFFKEGAVVFWNCSELEASNVLEFVKPYELESYPREVIEKEREIMTYIYQPNSKKCHLQ 700 IFFF+EGA VFWN + +V++ ++ +E++ Y ++ E E + YI K H Sbjct: 15 IFFFREGAAVFWNVKDKTMKHVMKVLEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRG 74 Query: 701 ESCFIMVPERDNS-LERFAFS 760 E + D++ LE+FAFS Sbjct: 75 EIKLNSELDLDDAILEKFAFS 95 >AL590413-1|CAI13588.1| 449|Homo sapiens required for meiotic nuclear division 1 homolog (S. cerevisiae) protein. Length = 449 Score = 54.4 bits (125), Expect = 4e-07 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = +2 Query: 521 IFFFKEGAVVFWNCSELEASNVLEFVKPYELESYPREVIEKEREIMTYIYQPNSKKCHLQ 700 IFFF+EGA VFWN + +V++ ++ +E++ Y ++ E E + YI K H Sbjct: 226 IFFFREGAAVFWNVKDKTMKHVMKVLEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRG 285 Query: 701 ESCFIMVPERDNS-LERFAFS 760 E + D++ LE+FAFS Sbjct: 286 EIKLNSELDLDDAILEKFAFS 306 >AK000634-1|BAA91299.1| 449|Homo sapiens protein ( Homo sapiens cDNA FLJ20627 fis, clone KAT03923. ). Length = 449 Score = 54.4 bits (125), Expect = 4e-07 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 1/81 (1%) Frame = +2 Query: 521 IFFFKEGAVVFWNCSELEASNVLEFVKPYELESYPREVIEKEREIMTYIYQPNSKKCHLQ 700 IFFF+EGA VFWN + +V++ ++ +E++ Y ++ E E + YI K H Sbjct: 226 IFFFREGAAVFWNVKDKTMKHVMKVLEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRG 285 Query: 701 ESCFIMVPERDNS-LERFAFS 760 E + D++ LE+FAFS Sbjct: 286 EIKLNSELDLDDAILEKFAFS 306 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,260,188 Number of Sequences: 237096 Number of extensions: 2189844 Number of successful extensions: 4156 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4156 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9757565650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -