BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021231 (745 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 23 2.6 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 22 6.0 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 430 ARVPRVNYFRFYTDMCMLSVGLVTL 356 +R R+NYF + + LSVGL+ + Sbjct: 54 SRKSRMNYFITHLALADLSVGLINV 78 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.8 bits (44), Expect = 6.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 607 RPQAALTYRQRARTLLPRCSIRKTNWTMQRRSPSNR 714 R AAL RAR L C + SPSNR Sbjct: 233 RVHAALVTSPRARPLARTCRDNRLLVLAGTSSPSNR 268 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,668 Number of Sequences: 336 Number of extensions: 4380 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -