BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021227 (657 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25108| Best HMM Match : Cornifin (HMM E-Value=0.00015) 59 3e-09 SB_54008| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_58912| Best HMM Match : rve (HMM E-Value=2.2e-17) 30 1.4 SB_56221| Best HMM Match : AOX (HMM E-Value=3.6) 30 1.4 SB_56113| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) 30 1.4 SB_55168| Best HMM Match : rve (HMM E-Value=2.2e-17) 30 1.4 SB_28953| Best HMM Match : rve (HMM E-Value=8.9e-07) 30 1.4 SB_24087| Best HMM Match : rve (HMM E-Value=2.2e-17) 30 1.4 SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) 30 1.4 SB_10735| Best HMM Match : rve (HMM E-Value=2.2e-17) 30 1.4 SB_2133| Best HMM Match : rve (HMM E-Value=2.2e-17) 30 1.4 SB_41308| Best HMM Match : rve (HMM E-Value=6e-12) 30 1.4 SB_32270| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_8751| Best HMM Match : zf-CCHC (HMM E-Value=0.01) 30 1.4 SB_27477| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_25367| Best HMM Match : TPR_1 (HMM E-Value=2.4e-40) 30 1.9 SB_19784| Best HMM Match : PHD (HMM E-Value=0.0006) 30 1.9 SB_17570| Best HMM Match : PHD (HMM E-Value=0.0006) 30 1.9 SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.9 SB_6316| Best HMM Match : tRNA_int_endo (HMM E-Value=0.016) 30 1.9 SB_2748| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7e-08) 30 1.9 SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) 30 1.9 SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_52861| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_22144| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_59742| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_32406| Best HMM Match : VWA (HMM E-Value=8.8e-32) 28 5.8 SB_12630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_49307| Best HMM Match : Pep_M12B_propep (HMM E-Value=0.64) 28 7.7 SB_7094| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_25108| Best HMM Match : Cornifin (HMM E-Value=0.00015) Length = 858 Score = 59.3 bits (137), Expect = 3e-09 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -2 Query: 506 MAAYFTHCKLQPVHQILTLRTALNMFFK 423 MAAYFTHC LQP+HQILTLRTA+N+FFK Sbjct: 1 MAAYFTHCNLQPIHQILTLRTAVNLFFK 28 >SB_54008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1940 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 562 SPWRVPRGSPCRRPITVGPRTARPWSPP 645 SP+R P S P+TVG R++RP SPP Sbjct: 1682 SPYRTP--SDRSSPLTVGGRSSRPRSPP 1707 >SB_58912| Best HMM Match : rve (HMM E-Value=2.2e-17) Length = 511 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 639 TP-RPSCPRPNSYWPSAGTTSWDSPWRPP 556 TP RPS P P GTT D+P RPP Sbjct: 437 TPTRPSPPLTRDTGPGTGTTGSDTPTRPP 465 >SB_56221| Best HMM Match : AOX (HMM E-Value=3.6) Length = 361 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 639 TP-RPSCPRPNSYWPSAGTTSWDSPWRPP 556 TP RPS P P GTT D+P RPP Sbjct: 287 TPTRPSPPLTRDTGPGTGTTGSDTPTRPP 315 >SB_56113| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) Length = 1163 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 639 TP-RPSCPRPNSYWPSAGTTSWDSPWRPP 556 TP RPS P P GTT D+P RPP Sbjct: 1089 TPTRPSPPLTRDTGPGTGTTGSDTPTRPP 1117 >SB_55168| Best HMM Match : rve (HMM E-Value=2.2e-17) Length = 1017 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 639 TP-RPSCPRPNSYWPSAGTTSWDSPWRPP 556 TP RPS P P GTT D+P RPP Sbjct: 943 TPTRPSPPLTRDTGPGTGTTGSDTPTRPP 971 >SB_28953| Best HMM Match : rve (HMM E-Value=8.9e-07) Length = 555 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 639 TP-RPSCPRPNSYWPSAGTTSWDSPWRPP 556 TP RPS P P GTT D+P RPP Sbjct: 481 TPTRPSPPLTRDTGPGTGTTGSDTPTRPP 509 >SB_24087| Best HMM Match : rve (HMM E-Value=2.2e-17) Length = 1229 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 639 TP-RPSCPRPNSYWPSAGTTSWDSPWRPP 556 TP RPS P P GTT D+P RPP Sbjct: 1155 TPTRPSPPLTRDTGPGTGTTGSDTPTRPP 1183 >SB_16757| Best HMM Match : S-antigen (HMM E-Value=0.56) Length = 1566 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/59 (27%), Positives = 26/59 (44%) Frame = -2 Query: 632 GRAVRGPTVIGRLQGLPRGTRHGDRQESDAEEHRRRTETYLQMAAYFTHCKLQPVHQIL 456 G A RG T P+G +H D + D + +R E+ + + C+ Q H+ L Sbjct: 946 GEARRGATSKEGETIQPKGNKHDDNKHYDERDVHKRAESRQSLQCWADECRSQHSHRRL 1004 >SB_10735| Best HMM Match : rve (HMM E-Value=2.2e-17) Length = 1013 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 639 TP-RPSCPRPNSYWPSAGTTSWDSPWRPP 556 TP RPS P P GTT D+P RPP Sbjct: 467 TPTRPSPPLTRDTGPGTGTTGSDTPTRPP 495 >SB_2133| Best HMM Match : rve (HMM E-Value=2.2e-17) Length = 425 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 639 TP-RPSCPRPNSYWPSAGTTSWDSPWRPP 556 TP RPS P P GTT D+P RPP Sbjct: 351 TPTRPSPPLTRDTGPGTGTTGSDTPTRPP 379 >SB_41308| Best HMM Match : rve (HMM E-Value=6e-12) Length = 581 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 639 TP-RPSCPRPNSYWPSAGTTSWDSPWRPP 556 TP RPS P P GTT D+P RPP Sbjct: 507 TPTRPSPPLTRDTGPGTGTTGSDTPTRPP 535 >SB_32270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 639 TP-RPSCPRPNSYWPSAGTTSWDSPWRPP 556 TP RPS P P GTT D+P RPP Sbjct: 211 TPTRPSPPLTRDTGPGTGTTGSDTPTRPP 239 >SB_8751| Best HMM Match : zf-CCHC (HMM E-Value=0.01) Length = 637 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -1 Query: 225 PEEKCSLCAASFMPEHKGKLCPVC-GVAEIGK 133 P EKCS+C + H+ LC C G + I K Sbjct: 102 PSEKCSVCLRTIARNHRAVLCDCCKGQSHIKK 133 >SB_27477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1800 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 225 PEEKCSLCAASFMPEHKGKLCPVC 154 P EKCS+C + H+ LC C Sbjct: 1007 PSEKCSVCLRTIARNHRAVLCDCC 1030 >SB_25367| Best HMM Match : TPR_1 (HMM E-Value=2.4e-40) Length = 553 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/60 (31%), Positives = 26/60 (43%) Frame = -2 Query: 506 MAAYFTHCKLQPVHQILTLRTALNMFFKLKNYRTAASFARRLLELGPRPEVAQQARKILQ 327 MAAYFT KL P + L L + K N + A F + L L P Q +++ Sbjct: 350 MAAYFTASKLMPKCHLPLLYIGLE-YGKTNNAKLAERFFKEALALSPNDPFVHQELGVIK 408 >SB_19784| Best HMM Match : PHD (HMM E-Value=0.0006) Length = 198 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 225 PEEKCSLCAASFMPEHKGKLCPVC 154 P EKCS+C + H+ LC C Sbjct: 35 PSEKCSVCLRTIARNHRAVLCDCC 58 >SB_17570| Best HMM Match : PHD (HMM E-Value=0.0006) Length = 243 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 225 PEEKCSLCAASFMPEHKGKLCPVC 154 P EKCS+C + H+ LC C Sbjct: 102 PSEKCSVCLRTIARNHRAVLCDCC 125 >SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1623 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 225 PEEKCSLCAASFMPEHKGKLCPVC 154 P EKCS+C + H+ LC C Sbjct: 102 PSEKCSVCLRTIARNHRAVLCDCC 125 >SB_6316| Best HMM Match : tRNA_int_endo (HMM E-Value=0.016) Length = 280 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = -1 Query: 270 IQRLRLSYKPIYRGKPEEKCSLCAASFMPEHKGK---LCPVCGVAEIGKDALGLRICPLQ 100 ++ L + + + +P CSLC S + EH K +C V +EI K+ L L C + Sbjct: 215 VEEKSLDTQNVVQSRPLTWCSLCGLSRVNEHAAKEVMICYVIKPSEIMKEDLILPSCIPR 274 Query: 99 F 97 F Sbjct: 275 F 275 >SB_2748| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7e-08) Length = 438 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 225 PEEKCSLCAASFMPEHKGKLCPVC 154 P EKCS+C + H+ LC C Sbjct: 102 PSEKCSVCLRTIARNHRAVLCDCC 125 >SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) Length = 775 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 225 PEEKCSLCAASFMPEHKGKLCPVC 154 P EKCS+C + H+ LC C Sbjct: 102 PSEKCSVCLRTIARNHRAVLCDCC 125 >SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 225 PEEKCSLCAASFMPEHKGKLCPVC 154 P EKCS+C + H+ LC C Sbjct: 750 PSEKCSVCLRTIARNHRAVLCDCC 773 >SB_52861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1487 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -3 Query: 616 AQQLLAVCRDYLVGLAMETARKAMPKN 536 A L AVC +YL +AMET + KN Sbjct: 988 ALDLFAVCLEYLKKVAMETINSTLSKN 1014 >SB_22144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +3 Query: 258 ADAEWIMLVVEQLVLISRGLLAGLEDLPRLLGDLRPG 368 A A I +V L ++RG+ GL D+ + LG+L PG Sbjct: 536 AVATTIAAIVTSLSSVARGVGNGLMDIGKKLGELLPG 572 >SB_59742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +3 Query: 222 PACRGRWACS*AADAEWIMLVVEQLVLISR 311 PA RG W S + +WI + ++LV++++ Sbjct: 202 PATRGAWVPSYGSFGQWIQIDFQRLVIVTK 231 >SB_32406| Best HMM Match : VWA (HMM E-Value=8.8e-32) Length = 1074 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = -1 Query: 621 PRPNSY-WPSAGTTSWDSPWRPPGKR 547 PRP WP G W P R PG+R Sbjct: 466 PRPGYRPWPRPGYRPWPRPGRTPGRR 491 >SB_12630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 639 TP-RPSCPRPNSYWPSAGTTSWDSPWRPP 556 TP RPS P P GTT D+P RPP Sbjct: 944 TPTRPSPPLTIYTGPGTGTTGSDTPTRPP 972 >SB_49307| Best HMM Match : Pep_M12B_propep (HMM E-Value=0.64) Length = 317 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/49 (26%), Positives = 29/49 (59%) Frame = -2 Query: 599 RLQGLPRGTRHGDRQESDAEEHRRRTETYLQMAAYFTHCKLQPVHQILT 453 +L+ LP+G DR+ +D +R++ + + + +H +L+P+ Q +T Sbjct: 35 QLKPLPQGVTECDREGADVLSTQRKSHLLILLTVHTSH-QLEPLSQGVT 82 >SB_7094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 260 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 614 PTVIGRLQGLPRGTRHGDRQESDAEEHRRRTETY 513 PT I R +P+G++HG +Q R+R T+ Sbjct: 81 PTKIIRFLTMPKGSKHGYKQSVVQTNTRKRKSTF 114 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,058,870 Number of Sequences: 59808 Number of extensions: 303659 Number of successful extensions: 1535 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 1428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1534 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -