BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021225 (720 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 105 1e-24 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 25 3.1 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 25 3.1 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 25 3.1 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.1 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 24 5.4 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 5.4 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 24 5.4 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 7.2 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 23 9.5 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 23 9.5 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 9.5 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 9.5 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 23 9.5 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 9.5 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 105 bits (252), Expect = 1e-24 Identities = 49/61 (80%), Positives = 56/61 (91%) Frame = +2 Query: 500 KTSTKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIED 679 + +TKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIFDLGGGTFDVSILTI++ Sbjct: 15 RQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDE 74 Query: 680 G 682 G Sbjct: 75 G 75 Score = 38.3 bits (85), Expect = 2e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +3 Query: 459 NAVITVPAYFNDSQRQAQK 515 +AVITVPAYFNDSQRQA K Sbjct: 1 DAVITVPAYFNDSQRQATK 19 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.6 bits (51), Expect = 3.1 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -1 Query: 717 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 619 W+ P T+ +P++ PPP + +T Sbjct: 221 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 253 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.1 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -1 Query: 717 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 619 W+ P T+ +P++ PPP + +T Sbjct: 222 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 254 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 24.6 bits (51), Expect = 3.1 Identities = 16/70 (22%), Positives = 33/70 (47%) Frame = -1 Query: 702 VDFTSKIPSSMVRMDTSKVPPPRSKISTFRSPVPFLSRP*AIAAAVGSLMIRRTFKPEMV 523 V F S+ P ++V D++ +K+S+ LSR + A++ L + P+ + Sbjct: 833 VKFISEYPRTLVANDSTNDLLSHNKVSSLHGSCDSLSRNVSQASSTSDLSKTISVAPDPI 892 Query: 522 PASFVLVFES 493 + L+ E+ Sbjct: 893 DINAKLITET 902 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 4.1 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 39 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 140 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 5.4 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 717 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 619 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDQPPPPPTTTTTT 254 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 5.4 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 717 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 619 W+ P T+ +P + PPP + +T Sbjct: 222 WIDPTATTTTHVPPTTTTWSDLPPPPPTTTTTT 254 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = -3 Query: 301 FMSACTVASSNLRPMSVWHRILCCWGSSPPGSWRHLR*DARCL 173 F+ T N+R SVW ++C + S LR CL Sbjct: 5 FVRTSTTHGINMRSSSVWLIVVCAVTVASANSEELLRGKENCL 47 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 7.2 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 14/70 (20%) Frame = -1 Query: 714 VSPAVDFTSKIPSSMVRMDTSKVPPP---RSKI---------STFRS-PVPF-LSRP*AI 577 +SP +F++ S++ ++ + PPP RSK T RS PVPF L+ P A Sbjct: 439 ISPPAEFSNGSSKSLLLLNGNGPPPPVPERSKTPNSIYLSQNGTPRSTPVPFALAPPPAA 498 Query: 576 AAAVGSLMIR 547 + A G +R Sbjct: 499 SPAFGDRSVR 508 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 717 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 619 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 254 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 717 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 619 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 254 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 717 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 619 W+ P T+ P++ PPP + +T Sbjct: 221 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 253 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 9.5 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 693 TSKIPSSMVRMDTSKVPPPRSKISTFRSPVPFLS-RP*AIAAA 568 T+K+ + M T+ PPP ++ +P P + +P + AAA Sbjct: 572 TTKLSTMMTTTTTTTEPPPIVQVIGLPAPTPRNNYKPSSAAAA 614 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 717 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 619 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 254 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 9.5 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 693 TSKIPSSMVRMDTSKVPPPRSKISTFRSPVPFLS-RP*AIAAA 568 T+K+ + M T+ PPP ++ +P P + +P + AAA Sbjct: 571 TTKLSTMMTTTTTTTEPPPIVQVIGLPAPTPRNNYKPSSAAAA 613 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 826,161 Number of Sequences: 2352 Number of extensions: 18330 Number of successful extensions: 51 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -