BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021223 (739 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein ... 25 3.2 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 4.3 AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding pr... 23 7.4 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 7.4 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 23 9.8 >AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein L8 protein. Length = 261 Score = 24.6 bits (51), Expect = 3.2 Identities = 15/56 (26%), Positives = 24/56 (42%) Frame = +1 Query: 454 RYTTM*KSWYKAF*RTIAGYPLEASHLKQNYQNLKEAKRIKNTPAPDTNTFIAATR 621 +Y W K R +A P+E H N+Q++ +A +K P + A R Sbjct: 188 KYKVKRNCWPKV--RGVAMNPVEHPHGGGNHQHIGKASTVKRGTPPGRKVGLIAAR 241 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 84 NELVKMLADGEIVGDGSWNLTIYVTDLNE 170 NE + +I G GSW + +TD +E Sbjct: 310 NENILGFIAADIKGTGSWTQMLLITDYHE 338 >AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding protein AgamOBP24 protein. Length = 176 Score = 23.4 bits (48), Expect = 7.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 502 IAGYPLEASHLKQNYQNLKEAKRIKNTPAPDTNTF 606 + G LEA H+++ +QN +E +K T N F Sbjct: 43 LQGARLEAEHVRRIHQNAREC--VKETGILPKNAF 75 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.4 bits (48), Expect = 7.4 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 276 SGGRLETNGSPDQNTP 323 SGGRL + G P TP Sbjct: 1011 SGGRLSSGGGPPVGTP 1026 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -1 Query: 268 VRPIFLNSLPKLSV 227 VR IF+N LPKL V Sbjct: 340 VRTIFINHLPKLLV 353 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 733,536 Number of Sequences: 2352 Number of extensions: 14627 Number of successful extensions: 38 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -