BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV021216 (688 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 25 0.58 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 2.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.3 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 25.0 bits (52), Expect = 0.58 Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +1 Query: 547 WVVKFNSL--NELVDYHRTASVSRLQDVKLRDVVPEKCW 657 + V SL NE+ ++HR +V L D+K+ + + W Sbjct: 285 YTVNLGSLGYNEICEFHRNGTVVFLDDMKVPYMYEDTFW 323 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.0 bits (47), Expect = 2.3 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 359 FSFVCNY*E*ALLSRLIQLCTSSYRPPC 276 F+F N LLS LI +C YR C Sbjct: 162 FAFPINLSVPVLLSGLIAMCGMYYRDEC 189 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.0 bits (47), Expect = 2.3 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 359 FSFVCNY*E*ALLSRLIQLCTSSYRPPC 276 F+F N LLS LI +C YR C Sbjct: 395 FAFPINLSVPVLLSGLIAMCGMYYRDEC 422 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.0 bits (47), Expect = 2.3 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 359 FSFVCNY*E*ALLSRLIQLCTSSYRPPC 276 F+F N LLS LI +C YR C Sbjct: 395 FAFPINLSVPVLLSGLIAMCGMYYRDEC 422 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,108 Number of Sequences: 336 Number of extensions: 3095 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -